KEGG   Kyrpidia tusciae: Btus_1381Help
Entry
Btus_1381         CDS       T01220                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bts  Kyrpidia tusciae
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bts00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Btus_1381
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Btus_1381
  Amino acid metabolism
   00310 Lysine degradation
    Btus_1381
Enzymes [BR:bts01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Btus_1381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1395585..1396892)
Genome map
AA seq 435 aa AA seqDB search
MADIKVPELGESIVEATILSWRKNEGDPVAKGETVAEVETDKVNVEVASEEDGVLEAILK
PAGETVFVGETIARIRSGAADQAAEHTPNQPARGQEPTPPETKHPNAGEKGLAVESRPVE
ASRGKTGPQTADNPSPAALDQATAPSSVTSPTPRTPSQRRRARQADGPQAAPATSAARTE
VVREATAPAAPVAPGTTAASPLRPDEERIPMTRRRQTIARRLLEAKQSTAMLTTFNEIDM
SAVLDLRRRRKDQFKEEHGVGLGFMSFFTRAAVGALKAFPMLNAEIEGNEIVVKHHYDIG
IAVATPAGLVVPVVRDADRLTFAEIESRIADLAKRAREGTLHPQELQGGTFTITNGGVFG
SLFSTPILNPPQVGILGMHAIKERPVAVEGQIVLRPMMYVALSYDHRIVDGAEAVQFLVK
VKEMVEDPETLLLEG
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
gtggcagacatcaaggtgcccgagctcggggagtccatcgtcgaggccacgatcctgagt
tggcgtaaaaatgagggtgatccggtggccaagggggaaacggtggcggaggtagaaacg
gacaaagtgaatgtggaggtggcatccgaggaagacggcgtgttggaggccattctgaaa
ccggcgggagagacggtcttcgtcggggaaaccatcgcccggatccgatcgggcgctgcc
gaccaggcggctgagcacaccccgaaccaaccggcccggggccaggagcccacccctccg
gaaaccaagcacccgaacgccggggaaaagggcctggcggtggaatcccgcccggtcgaa
gcctcccggggcaaaaccgggccccagacggcggataatccctcacccgccgccctggac
caggcgacggccccctcctcggtcacgtcgccgaccccgaggaccccttcccagcgccgc
agggctcgtcaggctgatggtccccaggccgcaccggcaacttctgcggcccggaccgag
gtcgttcgggaagccacggcccctgcggcccccgtggccccgggcacgacggccgcgtca
cccttgcggccggatgaagagcggattcccatgacccgcaggcgccaaaccatcgcccgg
cgactcctggaggccaaacagtccacggctatgttgacgacctttaatgagattgacatg
tccgcggtcttggatctccgccgtcggcgaaaggaccagttcaaagaagagcacggcgtg
ggactcggatttatgtcttttttcaccagggcggcggtgggcgccctcaaagcttttccc
atgttgaacgcggaaatagagggcaacgagatcgtcgtgaaacaccattacgacatcggc
atcgccgtcgccacccccgccggcttggtggtgccggtggtgcgggacgccgatcgcctc
acctttgccgagatcgaatcccggatcgccgatctggcgaagcgggcccgggaagggact
ctgcacccccaagaacttcagggcggcacgtttacgatcaccaacggcggggtgttcggg
tctctcttttccacccctatcctcaacccgccccaggtgggaattctcgggatgcacgcc
attaaagagcgtcccgtcgccgtggagggccagatcgtcctgcggccgatgatgtacgtg
gccctctcctacgatcaccgcatcgtcgacggggccgaggcggttcaattcctggtcaag
gtcaaagagatggtggaagacccggagacactgttgctggaaggttga

DBGET integrated database retrieval system