KEGG   Kyrpidia tusciae: Btus_1482Help
Entry
Btus_1482         CDS       T01220                                 

Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bts  Kyrpidia tusciae
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bts00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Btus_1482
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Btus_1482
   00640 Propanoate metabolism
    Btus_1482
   00660 C5-Branched dibasic acid metabolism
    Btus_1482
Enzymes [BR:bts01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Btus_1482
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1494645..1495802
Genome map
AA seq 385 aa AA seqDB search
MNIHEYQGKAILKTYGVAVPQGQVAFSVEEAVRIAEGLGGKAVVKAQIHAGGRGKAGGVK
VAKSLEQVREYAQQLLGSTLVTHQTGPEGKVVKRLLIEQLTDIQKEYYIGLVVDRATGRV
VIMASEEGGMEIEEVAAKTPEKIVRETIDPAVGFMPFQARKLAYAIHIPKPLVNKAVQFM
SGLYRAFVDKDCSVAEINPLVVTGDGNILALDAKLNFDSNGLFRHPELLELRDPDEEDPR
EQQAAKFGLSYIALDGNIGCMVNGAGLAMATMDIIKYYGGEPANFLDVGGGASTEKVTEA
FKIILQDEKVKGILVNIFGGIMKCDVIANGVVEAARQLGLDRPLVVRLEGTNVELGKKIL
AESGLKIVPADSMADAAEKIVSLVH
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcacgagtatcagggtaaagcgatcctcaaaacgtacggagtcgccgttccc
caggggcaggtggccttcagcgtcgaagaggcggtccggatcgccgaaggtcttggcggc
aaagcggttgtgaaagcgcagattcacgccggcgggcgtgggaaggccggcggcgtgaag
gtggcgaaatccctggaacaggttcgggagtatgcccagcagcttctcggttccactctg
gtgacccaccaaaccgggcctgaggggaaagtggttaagcgattgttgattgaacagttg
accgatattcagaaggagtattacataggactggtggtggaccgggcaacaggtagggtt
gtcatcatggcatcggaagaaggaggcatggagatcgaagaagtggccgcgaaaactccg
gagaagatcgtccgggagaccatcgacccggcggttggcttcatgcccttccaagcccgc
aaactggcctatgcgatccatattccgaaaccgctggtgaacaaggcggttcaatttatg
tctggactttaccgagcttttgtcgacaaagactgttcagtggcggaaattaatccactc
gtggtgaccggggacggaaacatcctggccctggatgccaagctcaattttgacagcaac
ggtttatttcgccacccggaacttttggagttgcgggatcccgatgaagaggatccccgc
gagcaacaagcggcgaaatttggcttgagctatattgcactggacggaaacatcgggtgc
atggtgaacggggccggattggccatggccacgatggacatcatcaagtattacggggga
gagccggcgaactttctcgatgtcggcggaggggcgagtaccgaaaaggttaccgaagcc
ttcaagattattcttcaggatgaaaaagtgaaagggatcttggtcaatatttttggcggc
atcatgaaatgtgacgtgattgcaaacggggttgtggaagccgcgcggcagttggggctc
gatcggccgctggtggtgcggctggaaggaacgaacgtggagttggggaaaaagattttg
gcagagtccggtttaaaaatcgtgccggccgattcgatggctgacgcggcggagaaaatc
gtatcgctggttcattga

DBGET integrated database retrieval system