KEGG   Kyrpidia tusciae: Btus_1717Help
Entry
Btus_1717         CDS       T01220                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bts  Kyrpidia tusciae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bts00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Btus_1717
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Btus_1717
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Btus_1717
Enzymes [BR:bts01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Btus_1717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1731133..1731954)
Genome map
AA seq 273 aa AA seqDB search
MSTSLQVALERRRRGGETGFIPFITAGDPTMEVTVEAVRRLVRAGADAVEIGMPYSDPLA
DGPTIQAASERALRGGFQMPDLFRLGPILREAAGEVPLVAFTYANPVYRWGWQTFAEDLA
KAGYAGVIVPDLPMEEATPLREAADRAGVALVPLVAPTSHGRIERICRTARGFVYAVSST
GVTGVRKRMPEHLSRFIDDIRRCTDLPIGVGFGIGTPEAAAAVAETADAVIVGSALVRIL
AAITEEGKDAGDVLDDLETFARTLVAPLRRAGK
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgagcacctccttgcaggttgccttggagagacgacggcgcgggggggaaaccgggttc
attccctttatcaccgccggggaccccacgatggaggtcaccgtggaggcggtgcggaga
ttggtccgggccggggcggacgctgtggagatcgggatgccctattccgatcccctggcc
gacggtcccaccattcaggcggcttccgagcgggctttgcgcggcgggtttcagatgccc
gatttgtttcggctgggaccgatccttcgggaggcggcgggggaggtgcctttggtggct
tttacctatgcaaaccccgtctaccgctggggatggcagaccttcgcggaagacctggcg
aaggcgggatatgccggggtgatcgtgccggatctgcccatggaagaggcgactccttta
cgggaggccgccgaccgggcgggggtggcactggtgccgcttgtcgcacccaccagccac
gggcggatcgaacggatttgcagaacggccaggggattcgtctatgccgtgtcctccacg
ggggtcacgggtgtccgcaaacggatgcccgagcacctttccaggttcattgacgacatc
cggcggtgcaccgatctgccgatcggcgtgggcttcgggatcggaaccccggaggcggcg
gctgcggtggccgagacggccgacgcggtgattgtggggagcgccttggtgcgcatcctg
gccgccatcaccgaagaaggaaaagatgccggcgacgtgctggacgatctcgagactttt
gcccgaacattggtggctcccttgcgaagggccgggaaatga

DBGET integrated database retrieval system