KEGG   Kyrpidia tusciae: Btus_1718Help
Entry
Btus_1718         CDS       T01220                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bts  Kyrpidia tusciae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bts00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Btus_1718
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Btus_1718
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Btus_1718
Enzymes [BR:bts01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Btus_1718
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1731951..1733153)
Genome map
AA seq 400 aa AA seqDB search
MTEPDERGRFGRFGGQYVPETLMSALEALEKDYLKWKDDERFCNDLHRFLTDYAGRPTPL
YFAERLTNHVGGAQIWLKREDLTHTGAHKINNTIGQGLLAHYTGKRRVIAETGAGQHGVA
TATVAARLGLSCTVFMGEEDIRRQALNVFRMRLLGAEVVSVSSGTGTLKDAMNEAIRHWV
EHVEDSFYVLGTVGGPHPYPVMVRNFQRVIGDETRAQILEKVGRLPDAIVACVGGGSNAM
GIFYPFLEDEGVRLFGVEAAGKGLSTGLHAAALEGGEPGILHGCFTYLLQDRYGQVKPAH
SISAGLDYPGVGPEHAYLYETGRVKYVGVTDDQALDAFHRLAELEGILPALESAHAVAYT
LELARKMDPDQVVVISLSGRGDKDVETLMRQQSGLGGDSE
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgacggaacccgatgagcggggacggttcggccgatttggggggcagtacgtcccggaa
acgttgatgtccgccctggaggcgctggaaaaagattatctcaagtggaaggatgacgaa
cgtttttgcaacgacctgcaccggtttttgaccgattatgccgggcggccgacgccgctg
tattttgcggagcggttgaccaatcatgttggaggggcgcagatttggctgaagcgggaa
gacttgacccacaccggcgctcacaagatcaacaacaccatcggtcaaggactcttggcc
cattatacgggaaaacggcgggtcatcgccgagaccggggcgggtcagcacggggtggcc
acagcgacggtggcggcccggctcggtttgtcttgtaccgtgttcatgggtgaagaggat
atccggcgccaggcgttgaacgtgtttcgcatgcgtctgttgggggcggaggtggtgtcg
gtctcgtcggggaccggcaccctgaaggacgcgatgaacgaggcgatccggcactgggtg
gagcatgtggaggacagcttttacgtgctcggcaccgtgggcgggccccatccgtatccg
gtgatggtgcggaatttccagcgggtcatcggggacgaaaccagggcccagatcctggag
aaggtcgggcgcctgcccgacgccatcgtcgcctgcgtcggaggcggtagcaacgccatg
gggattttctatccgtttctcgaagacgagggtgtgcgtttgttcggcgtcgaggcggcg
ggcaaggggttgtccaccggccttcacgcggcggctttggaggggggggagcccgggatt
ctgcacgggtgcttcacgtacctcttgcaggatcgctacggtcaggttaaaccggcccat
tccatctcggcgggtcttgattatcccggggtgggtcctgagcacgcctacctctatgaa
accggccgggtgaagtacgtgggcgtgacggacgatcaggccctggatgcctttcaccga
ttggcggagttggaggggattctgcctgccctggagagcgcccacgccgtggcctatacc
ctggaattggccagaaagatggatccggatcaggtggttgtgatcagcctgtccgggcgc
ggggataaagatgtggaaaccctcatgcggcaacagtccggccttggaggtgattcggaa
tga

DBGET integrated database retrieval system