KEGG   Kyrpidia tusciae: Btus_1720Help
Entry
Btus_1720         CDS       T01220                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bts  Kyrpidia tusciae
Pathway
bts00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bts01100  Metabolic pathways
bts01110  Biosynthesis of secondary metabolites
bts01130  Biosynthesis of antibiotics
bts01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bts00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Btus_1720
Enzymes [BR:bts01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Btus_1720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE FMN_dh ThiG QRPTase_C His_biosynth NMO
Motif
Other DBs
NCBI-ProteinID: ADG06422
JGI: Btus_1720
UniProt: D5WQ13
Position
complement(1733775..1734572)
Genome map
AA seq 265 aa AA seqDB search
MTILERIVEEKKREIPALEANAAAWEPRLAAAPPVRDFRAALEQGATRRGAGAGVGLIAE
VKKASPSKGVIRRDFDPLAIAKDYVRGGADCMSVLTDRTFFQGDPGYLEQIRKHADVPLL
RKDFIVDERQVWEARCLGADAVLLITAILPSDRLERLIAEVRRWGMTPLVEVHSEEEMDR
AAGAGADVIGVNNRDLRTFQVDLGVTERLVPRAPKGAFVISESGISEPEDVRRVREAGAR
AILVGESLMRRDDVIEGIEFLVGSR
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
gtgaccatcctcgagcggattgtcgaggaaaagaaacgggagatcccggccctggaggca
aacgcggcggcctgggagccccgcttggccgccgcgccgccggtgagggattttcgcgcc
gcactggaacaaggggcgacgcgccggggggcgggggccggagtcgggctgattgccgag
gtcaagaaagcctccccttccaaaggggtgatccgccgggatttcgatcccctcgccatc
gcgaaggattatgtgcgcggaggggcggactgtatgtccgtcctcactgaccggaccttt
ttccagggcgacccggggtatttggaacagatccgcaaacacgccgatgtgcccctcctg
agaaaagattttattgtggatgagcgacaggtgtgggaggctcgttgtctcggggcagat
gcagttctcctgatcaccgcaattctcccgagtgatcggctggaacggttgattgccgag
gtccgtcggtggggcatgacgcctttggtggaggtgcactccgaggaagagatggatcgg
gctgccggtgcgggggccgatgtgatcggagtgaacaaccgggatttgcggacctttcag
gtggatctcggcgtgacggagcggctggtgcctcgggcgccgaaaggggccttcgtgata
agtgaaagtgggatttcggagcccgaggacgtgcgccgggtacgagaggccggcgcccgg
gccattctcgtgggcgagagtttgatgcgccgggatgacgtcatcgaagggattgagttc
ctggtgggttcccggtga

DBGET integrated database retrieval system