KEGG   Kyrpidia tusciae: Btus_1763Help
Entry
Btus_1763         CDS       T01220                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bts  Kyrpidia tusciae
Pathway
bts00010  Glycolysis / Gluconeogenesis
bts00620  Pyruvate metabolism
bts00640  Propanoate metabolism
bts00680  Methane metabolism
bts01100  Metabolic pathways
bts01110  Biosynthesis of secondary metabolites
bts01120  Microbial metabolism in diverse environments
bts01130  Biosynthesis of antibiotics
bts01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bts00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Btus_1763
   00620 Pyruvate metabolism
    Btus_1763
   00640 Propanoate metabolism
    Btus_1763
  Energy metabolism
   00680 Methane metabolism
    Btus_1763
Enzymes [BR:bts01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Btus_1763
Lipid biosynthesis proteins [BR:bts01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Btus_1763
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C Atu4866
Motif
Other DBs
NCBI-ProteinID: ADG06463
JGI: Btus_1763
UniProt: D5WQ54
Position
complement(1776315..1777898)
Genome map
AA seq 527 aa AA seqDB search
MQPSIEIPEIYNFAAVVDDYAEDGSRIAIVAVTEDRQEEYVPYWRLKDLSNRFANVLTAQ
GIGRGDRVIVTLPRSVDAYVVYLGLLKVGAVVMPGSEMLRAKDLAYRIQHAGAKAVVAFE
GIRNEFEAIRDQCPTAERYLLFGQAPGWVDLRAEMAQADRNFEPVPTRSDELAFLSYTSG
TTGGPKGVMHTHSWPAAHVQVAATYWFDVRPGEIAWATAGPGWAKWVWSPFVSILGRGGT
AFVYRGRFDPKVYLDLLCEYPIGLFCATPTEYRLMAKVQGLEKYRPRALRSAVSAGEPLN
REVIDTFQRHFGVLVRDGYGQTENSLMVGTTVDTPVRPGSMGRPFPAYRIAVVDEDGREL
PPGQVGDIAIHRDAATLFKGYLDDPDRTEKAFRGEWYITGDQAKMDEDGYFWFEGRADDI
IISAGYTIGPFEVEDALVKHPAVAECAAVASPDPERGNIVKAFVVLREGYTGSPELTAEL
QEHVKNTTAPYKYPREIEYVDGLPKTTSGKIRRVELRAQERERKLSK
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccatccatcgagataccggagatttataattttgccgcagtggtggatgactac
gcagaagacgggagccggatcgccattgtcgccgtcaccgaggaccgtcaggaggaatat
gtcccgtactggcgtctgaaagatctgtcgaataggttcgccaacgttctgaccgcccag
gggatcggtcgaggggaccgggtgatcgtcacattacctcgctcggtggatgcctatgtg
gtgtacctggggttgttaaaggtcggtgccgtggtcatgcccggttcagagatgttgcgg
gcgaaagacctggcctatcggattcaacacgccggggccaaggcggtggtggcctttgag
gggattcggaacgagtttgaagccatccgggaccagtgcccgacggcggagcggtatcta
cttttcggacaggccccggggtgggtggaccttcgggccgagatggcccaggctgaccga
aactttgagccagtacccacccggtcggacgaattggcttttttgtcctacacctccgga
accacgggggggccaaaaggggtgatgcatacccattcttggccggctgcccatgtccaa
gtggcggcgacctattggttcgacgtacggccgggggagatcgcctgggcgacggcgggg
ccgggatgggcgaagtgggtctggagtcccttcgtgtccattctcggcagagggggaacg
gctttcgtgtaccgggggcgctttgacccgaaggtctatctcgaccttttgtgcgagtat
cccatcgggcttttctgcgcgaccccgacggaataccgattgatggccaaagtccagggt
ctagagaagtatcgtccgcgggccctgcgcagcgcagtgagcgccggagaacccctgaac
cgcgaagtgatcgacacgtttcaacggcatttcggcgtgttggttcgggacggatacggc
cagacggagaactcgctgatggtggggaccacggtggataccccggtgcgcccgggttcc
atgggccggcctttcccggcctatcgcatcgccgtggtggacgaagatgggcgggaactg
cccccgggccaagtgggggatatcgccattcaccgggatgctgcgacgttgttcaaggga
tatttggacgatcccgaccgcacggaaaaggcgtttcgcggcgagtggtatatcaccgga
gaccaggccaagatggatgaggacggatatttctggtttgaagggcgggcggacgacatc
atcatcagtgcggggtacacgatcgggccctttgaggtggaagatgccctggtgaaacat
ccggcggtggcggagtgcgcggcggtggccagcccggatcccgagcgggggaacatcgtc
aaagccttcgtggtgcttcgggagggttataccggatccccggagttgacggcggagctg
caggagcatgttaaaaacacaacggccccttataaatatcctcgggagattgaatatgtg
gacggcttgccgaagacgacgtccggtaagatccgccgggttgaactacgggctcaggaa
cgagagcgcaagttgagcaagtaa

DBGET integrated database retrieval system