KEGG   Kyrpidia tusciae: Btus_1855Help
Entry
Btus_1855         CDS       T01220                                 

Definition
UDP-N-acetylglucosamine1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bts  Kyrpidia tusciae
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bts00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:bts00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1863217..1864485)
Genome map
AA seq 422 aa AA seqDB search
MKALDRIAVEGGTPLEGAVRVHGAKNAALPILAATLLAEGVCVVEDVPDLQDIRVMVDIL
RALGASVDYSPPVVRVDARRISRTEVPEELMRQMRSSIFLMGPLLARYCHARVSRPGGCT
IGSRPIDLHLKGLAALGASIDEMHGYIDCRTRRLHGAAIYLDTPSVGATENLMMAAVLAE
GTTVIGNAAREPEIVDLANFLNRLGARVEGAGEDTLVISGVQGLIGGQHAIIPDRIVAGT
LAIAVSMTGGDVTLENVRPNHLGAVLTKLREAGVEIETGRDIMRVRSHGKLRAVEQVRTA
PYPGFPTDLQAPFMALLSVAPGMSIVAETVFEERFKHVSELCRMGANIRVDLRTAFVQGV
PRLTGAVVQASDLRAGAALVLAGLVAEGTTVVEQAHHIDRGYQQFDEMLRGLGARVRRLS
QS
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggccttggatcgaatcgccgttgaagggggcacgccgctggagggtgcggtgagg
gtgcacggcgccaaaaatgcggcgttgccgattctcgcagccactctgctggccgaaggg
gtctgtgttgtcgaagacgtgccggatcttcaggacattcgcgtcatggtcgacattctg
cgggccctcggggcatcggtggattattcgcctcccgtcgtccgggtggacgcccggcgg
atctcccgaacggaagtgccggaggaattgatgcggcaaatgcgttcgtccatcttcctc
atgggtcctctccttgctcgatattgccacgcccgggtctcccgccccggcgggtgtaca
atcggttcgcgtccgattgatcttcatttgaagggacttgcggcgttgggggcgtccatc
gacgaaatgcatggctacatcgattgccggacccgccggttacatggcgcagcgatttat
ttggataccccgagtgtcggggcgacggaaaacctgatgatggccgcggtcctcgccgag
gggaccacggtgatcggcaatgcggcccgggaaccggaaatcgtcgatctggccaatttt
ctcaaccgacttggagcgcgggttgagggggcgggggaagatactctggttatttccggg
gttcaagggcttattggagggcagcatgcgatcatacccgatcgcattgtggcggggacg
ctggccattgccgtcagcatgaccggtggcgatgtgacgctggagaacgtccgtccgaat
catttgggggctgtattgacgaaattgcgcgaggccggtgttgaaatcgaaaccggccgt
gatataatgagggtgcgttcgcacgggaagctgcgggcggtggagcaggtgcgcaccgcg
ccctatccggggtttcccacggatcttcaagctcctttcatggccttgttgagcgtggct
ccagggatgtccattgtggcggagacggtttttgaagagcggttcaaacacgtcagtgaa
ctgtgccgcatgggggccaatattcgagtggatctgcgcaccgcctttgtgcaaggggtg
ccgcgcctgaccggggcggtggtgcaggcgagcgatttgcgggcaggtgcagctttggta
ttggcgggtcttgtggcagaaggcacaacggtggtggagcaggctcaccatattgaccgc
ggatatcagcaattcgacgagatgctgcgggggcttggagcccgggtgcggcgcttgtcc
caatcatag

DBGET integrated database retrieval system