KEGG   Kyrpidia tusciae: Btus_2038Help
Entry
Btus_2038         CDS       T01220                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bts  Kyrpidia tusciae
Pathway
bts00010  Glycolysis / Gluconeogenesis
bts00071  Fatty acid degradation
bts00350  Tyrosine metabolism
bts00625  Chloroalkane and chloroalkene degradation
bts00626  Naphthalene degradation
bts01100  Metabolic pathways
bts01110  Biosynthesis of secondary metabolites
bts01120  Microbial metabolism in diverse environments
bts01130  Biosynthesis of antibiotics
bts01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bts00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Btus_2038
  Lipid metabolism
   00071 Fatty acid degradation
    Btus_2038
  Amino acid metabolism
   00350 Tyrosine metabolism
    Btus_2038
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Btus_2038
   00626 Naphthalene degradation
    Btus_2038
Enzymes [BR:bts01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Btus_2038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 TMP-TENI AlaDh_PNT_C Methyltransf_25 Methyltransf_11
Motif
Other DBs
NCBI-ProteinID: ADG06728
JGI: Btus_2038
UniProt: D5WQW9
Position
2040087..2041097
Genome map
AA seq 336 aa AA seqDB search
MKAAVVHSFSEPLRIEDVPKPTPGEGEIVVKIEASGLCHTDIHAAHGDWPIKPKLPFIPG
HEGVGIVESVGEGVTRVKEGDRVAIPWLGYACGHCKYCVSGWETLCQSQKQTGYILDGAY
AEYAKAYADYVGIVPKGVDPFDAAPLTCAGVTTYKAVKMSGARPSSLVAVFGIGGLGHLA
MQYAKVAGASVVAVDLVDEKLDLAKQLGADFVINGRKQDPVAEIQKLGGADAAISVAVSP
KAFEQAYQSLHPGGTVVFVALPADNYVQIPIFETVLNAIRIQGSIVGTRVDLQEVFDIHA
SGLTKVMHERRKLDDVNECFHEVESAKAKARLVFEI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgctgtcgttcacagtttcagcgaaccgttacgcattgaggatgtgccgaag
cccacacctggtgaaggcgaaattgtcgtgaagattgaagcctccggactttgccacacg
gatatccacgccgcccatggcgactggccgatcaaacccaagctgccctttattcccggc
catgagggcgtcgggatcgtggaaagtgtcggcgaaggcgtcacccgggtcaaagaagga
gatcgagtggcgattccctggctgggatacgcttgcggccactgtaagtattgcgtaagt
ggctgggaaacgctctgccagagccaaaagcagaccggatacatcctggatggggcctat
gccgagtatgccaaggcttatgcggattatgtcggaattgtccccaaaggagtggatccg
ttcgacgcggctccacttacatgtgccggggtcaccacgtacaaggccgtcaagatgtct
ggagctcgaccctcttccctggtggccgtattcggtatcggcggtcttggacacctcgcc
atgcagtacgcgaaagtcgccggcgcatcggtagtcgctgtggatttagtggacgaaaaa
ttggatttggccaagcagctgggggcggatttcgttatcaacggacgaaaacaggacccc
gttgcggaaattcagaagctcggtggagccgacgccgccatcagcgtggcggtatcaccg
aaggccttcgagcaagcgtatcaaagcctccatccaggtggcaccgtggtgttcgtggcg
cttccagccgacaactacgttcagattccgattttcgaaacggtcctcaacgccatccgg
attcaaggatcgattgtgggaacccgggtagatctgcaagaagtgtttgacattcatgcg
tcgggcttgacaaaagtgatgcacgaacgacggaagttggatgatgtgaacgaatgtttc
cacgaagttgaaagcgccaaagccaaggcgcggttggtgtttgaaatctga

DBGET integrated database retrieval system