KEGG   Kyrpidia tusciae: Btus_2038Help
Entry
Btus_2038         CDS       T01220                                 

Definition
alcohol dehydrogenase GroES domain-containing protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bts  Kyrpidia tusciae
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bts00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Btus_2038
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Btus_2038
  Lipid metabolism
   00071 Fatty acid degradation
    Btus_2038
  Amino acid metabolism
   00350 Tyrosine metabolism
    Btus_2038
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Btus_2038
   00626 Naphthalene degradation
    Btus_2038
Enzymes [BR:bts01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Btus_2038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2040087..2041097
Genome map
AA seq 336 aa AA seqDB search
MKAAVVHSFSEPLRIEDVPKPTPGEGEIVVKIEASGLCHTDIHAAHGDWPIKPKLPFIPG
HEGVGIVESVGEGVTRVKEGDRVAIPWLGYACGHCKYCVSGWETLCQSQKQTGYILDGAY
AEYAKAYADYVGIVPKGVDPFDAAPLTCAGVTTYKAVKMSGARPSSLVAVFGIGGLGHLA
MQYAKVAGASVVAVDLVDEKLDLAKQLGADFVINGRKQDPVAEIQKLGGADAAISVAVSP
KAFEQAYQSLHPGGTVVFVALPADNYVQIPIFETVLNAIRIQGSIVGTRVDLQEVFDIHA
SGLTKVMHERRKLDDVNECFHEVESAKAKARLVFEI
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgctgtcgttcacagtttcagcgaaccgttacgcattgaggatgtgccgaag
cccacacctggtgaaggcgaaattgtcgtgaagattgaagcctccggactttgccacacg
gatatccacgccgcccatggcgactggccgatcaaacccaagctgccctttattcccggc
catgagggcgtcgggatcgtggaaagtgtcggcgaaggcgtcacccgggtcaaagaagga
gatcgagtggcgattccctggctgggatacgcttgcggccactgtaagtattgcgtaagt
ggctgggaaacgctctgccagagccaaaagcagaccggatacatcctggatggggcctat
gccgagtatgccaaggcttatgcggattatgtcggaattgtccccaaaggagtggatccg
ttcgacgcggctccacttacatgtgccggggtcaccacgtacaaggccgtcaagatgtct
ggagctcgaccctcttccctggtggccgtattcggtatcggcggtcttggacacctcgcc
atgcagtacgcgaaagtcgccggcgcatcggtagtcgctgtggatttagtggacgaaaaa
ttggatttggccaagcagctgggggcggatttcgttatcaacggacgaaaacaggacccc
gttgcggaaattcagaagctcggtggagccgacgccgccatcagcgtggcggtatcaccg
aaggccttcgagcaagcgtatcaaagcctccatccaggtggcaccgtggtgttcgtggcg
cttccagccgacaactacgttcagattccgattttcgaaacggtcctcaacgccatccgg
attcaaggatcgattgtgggaacccgggtagatctgcaagaagtgtttgacattcatgcg
tcgggcttgacaaaagtgatgcacgaacgacggaagttggatgatgtgaacgaatgtttc
cacgaagttgaaagcgccaaagccaaggcgcggttggtgtttgaaatctga

DBGET integrated database retrieval system