KEGG   Kyrpidia tusciae: Btus_2137Help
Entry
Btus_2137         CDS       T01220                                 

Definition
Carboxylesterase (EC:3.1.1.1)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
bts  Kyrpidia tusciae
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2139623..2140399)
Genome map
AA seq 258 aa AA seqDB search
MKEDQEFTEASPEPFFFPGGSVGILLVHGFTGSPSEMRPMGQWFAQQGYTVAGPLLAGHG
TSPLDMERTGWRDWVASARDAAKKLRERSSRIVAAGLSMGGALSLYLGSGVAGVPVDAVI
SMCAPIYLQDRRAHLARFVAPIHPFHRDGSAGHPPEIRRYLAGYDITPTRCVGELMTLIR
RTKRLLPGVRVPTLVLQARRDRTVRPKSAQYIYARVGTSDKALRWYEQSGHILTVDRDRE
AVWRDVLDWLRGHDLAPR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggaagaccaggaatttacggaggcgtcgcccgagccgtttttcttccccgggggt
tcagtggggattctgctggtgcacgggtttaccggttcgccttcggaaatgagaccgatg
ggtcagtggtttgcccagcaggggtataccgtggcggggccgctgttggcggggcacggc
acgtctccgttagatatggaacgaacaggctggagggattgggtggcctccgcccgggat
gcagcgaaaaagttgcgggaacggagttcccggatcgtggcggcgggcctgtctatgggg
ggtgctttgtcgttgtatctcgggtccggggtggcgggggttccggtggatgcggtgatc
tccatgtgtgcccctatctatttacaggatcggagggcgcacctggcccgttttgtcgcg
cccattcacccgtttcaccgggacggaagcgccgggcatcctccggagattcgacggtat
ctcgccggttatgatatcacgcccacccgatgtgtcggcgaactgatgaccttgatccgg
cggaccaagcgattgttgcccggggtgcgagtccccaccttggtgcttcaagcccggcgg
gatcgaacggtgcgcccgaagtccgcccagtacatttatgcccgggttggcacgtccgac
aaagcgttgcgttggtacgagcagtccggccatattctgactgtcgaccgggaccgggaa
gcggtgtggcgggatgtgctcgattggctgaggggacacgatttggcgccacgatga

DBGET integrated database retrieval system