KEGG   Kyrpidia tusciae: Btus_2141Help
Entry
Btus_2141         CDS       T01220                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bts  Kyrpidia tusciae
Pathway
bts00010  Glycolysis / Gluconeogenesis
bts00051  Fructose and mannose metabolism
bts00562  Inositol phosphate metabolism
bts00710  Carbon fixation in photosynthetic organisms
bts01100  Metabolic pathways
bts01110  Biosynthesis of secondary metabolites
bts01120  Microbial metabolism in diverse environments
bts01130  Biosynthesis of antibiotics
bts01200  Carbon metabolism
bts01230  Biosynthesis of amino acids
Module
bts_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bts_M00002  Glycolysis, core module involving three-carbon compounds
bts_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bts00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Btus_2141
   00051 Fructose and mannose metabolism
    Btus_2141
   00562 Inositol phosphate metabolism
    Btus_2141
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Btus_2141
Enzymes [BR:bts01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Btus_2141
Exosome [BR:bts04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Btus_2141
  Exosomal proteins of bladder cancer cells
   Btus_2141
  Exosomal proteins of melanoma cells
   Btus_2141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADG06819
JGI: Btus_2141
UniProt: D5WR89
Position
complement(2143661..2144467)
Genome map
AA seq 268 aa AA seqDB search
MNAARKPLLAANWKMNKTPEEALAFWREFSGRLSGESERVEVVICPPYTALPALDGANLR
ARGVYLGAQNVHWEPRGAFTGEVSPGMLRAVGCSHVIVGHSERRAYFGESDEAVQRKLQA
ALDEGMTPILCVGETLEQRTAGRAEEVVAAQLTAALEGLDTGRAARVVVAYEPVWAIGTG
RSAEARDAGEMAAAVRRRLRDLAGPAAEEIRILYGGSVAPDNFVQFLAEAEVDGGLVGTA
SLRPESFFALVAAAAKAAAAQAGKGEAQ
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcggcccggaaaccgcttttggcggcgaactggaagatgaacaaaacgcccgag
gaggccctggccttttggcgcgagttttcgggccggttgtcgggggagagcgagcgggtg
gaggtggtgatttgtccgccttacaccgcgctgcccgccctagacggggcgaacctccgg
gctcggggagtgtacttgggggcccagaacgtccactgggagccccggggggcgttcacc
ggcgaggtgtcgcccgggatgctccgggccgtggggtgctctcatgtgatcgtgggccat
tctgaacgacgggcctattttggcgagtcggacgaggcggtgcagcgaaagttacaggcg
gcgctcgacgaagggatgacgccgattctctgcgtcggcgagacgttggaacagcgcacg
gcgggtcgggcagaagaggtggtggccgcccagctcaccgccgctttagaaggacttgac
accggccgggcggcccgggtggtcgtggcttacgagccggtgtgggcgatcgggaccggg
cggtccgccgaggcccgggatgccggggaaatggcggcggcggtgaggcgcaggctgcgg
gatttggcgggccccgcggcggaggagatccggattctgtacgggggcagcgtggccccg
gataattttgtgcagtttttggcggaggccgaggtggacggcgggctcgtgggcacggcg
agtttgcgtccagaatcgtttttcgccttggtggccgcggcggcaaaggccgctgctgcc
caggcggggaaaggagaggcacaatga

DBGET integrated database retrieval system