KEGG   Kyrpidia tusciae: Btus_2141Help
Entry
Btus_2141         CDS       T01220                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bts  Kyrpidia tusciae
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bts00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Btus_2141
   01230 Biosynthesis of amino acids
    Btus_2141
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Btus_2141
   00051 Fructose and mannose metabolism
    Btus_2141
   00562 Inositol phosphate metabolism
    Btus_2141
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Btus_2141
Enzymes [BR:bts01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Btus_2141
Exosome [BR:bts04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Btus_2141
  Exosomal proteins of bladder cancer cells
   Btus_2141
  Exosomal proteins of melanoma cells
   Btus_2141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2143661..2144467)
Genome map
AA seq 268 aa AA seqDB search
MNAARKPLLAANWKMNKTPEEALAFWREFSGRLSGESERVEVVICPPYTALPALDGANLR
ARGVYLGAQNVHWEPRGAFTGEVSPGMLRAVGCSHVIVGHSERRAYFGESDEAVQRKLQA
ALDEGMTPILCVGETLEQRTAGRAEEVVAAQLTAALEGLDTGRAARVVVAYEPVWAIGTG
RSAEARDAGEMAAAVRRRLRDLAGPAAEEIRILYGGSVAPDNFVQFLAEAEVDGGLVGTA
SLRPESFFALVAAAAKAAAAQAGKGEAQ
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcggcccggaaaccgcttttggcggcgaactggaagatgaacaaaacgcccgag
gaggccctggccttttggcgcgagttttcgggccggttgtcgggggagagcgagcgggtg
gaggtggtgatttgtccgccttacaccgcgctgcccgccctagacggggcgaacctccgg
gctcggggagtgtacttgggggcccagaacgtccactgggagccccggggggcgttcacc
ggcgaggtgtcgcccgggatgctccgggccgtggggtgctctcatgtgatcgtgggccat
tctgaacgacgggcctattttggcgagtcggacgaggcggtgcagcgaaagttacaggcg
gcgctcgacgaagggatgacgccgattctctgcgtcggcgagacgttggaacagcgcacg
gcgggtcgggcagaagaggtggtggccgcccagctcaccgccgctttagaaggacttgac
accggccgggcggcccgggtggtcgtggcttacgagccggtgtgggcgatcgggaccggg
cggtccgccgaggcccgggatgccggggaaatggcggcggcggtgaggcgcaggctgcgg
gatttggcgggccccgcggcggaggagatccggattctgtacgggggcagcgtggccccg
gataattttgtgcagtttttggcggaggccgaggtggacggcgggctcgtgggcacggcg
agtttgcgtccagaatcgtttttcgccttggtggccgcggcggcaaaggccgctgctgcc
caggcggggaaaggagaggcacaatga

DBGET integrated database retrieval system