KEGG   Kyrpidia tusciae: Btus_2339Help
Entry
Btus_2339         CDS       T01220                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bts  Kyrpidia tusciae
Pathway
bts00071  Fatty acid degradation
bts00280  Valine, leucine and isoleucine degradation
bts00281  Geraniol degradation
bts00310  Lysine degradation
bts00360  Phenylalanine metabolism
bts00362  Benzoate degradation
bts00380  Tryptophan metabolism
bts00410  beta-Alanine metabolism
bts00627  Aminobenzoate degradation
bts00640  Propanoate metabolism
bts00650  Butanoate metabolism
bts00903  Limonene and pinene degradation
bts00930  Caprolactam degradation
bts01100  Metabolic pathways
bts01110  Biosynthesis of secondary metabolites
bts01120  Microbial metabolism in diverse environments
bts01130  Biosynthesis of antibiotics
bts01212  Fatty acid metabolism
Module
bts_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bts00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Btus_2339
   00650 Butanoate metabolism
    Btus_2339
  Lipid metabolism
   00071 Fatty acid degradation
    Btus_2339
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Btus_2339
   00310 Lysine degradation
    Btus_2339
   00360 Phenylalanine metabolism
    Btus_2339
   00380 Tryptophan metabolism
    Btus_2339
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Btus_2339
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Btus_2339
   00281 Geraniol degradation
    Btus_2339
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Btus_2339
   00627 Aminobenzoate degradation
    Btus_2339
   00930 Caprolactam degradation
    Btus_2339
Enzymes [BR:bts01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Btus_2339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ADG07006
JGI: Btus_2339
UniProt: D5WSI7
Position
complement(2364620..2365465)
Genome map
AA seq 281 aa AA seqDB search
MRTRYPKIHEEGRRVYESYETLTFERRGTILTVRLTNPGSRNSVNQKMHEELSRVFVDIS
RDRETRIVVLRGAEEGRAFCAGGDLHWLETEARTPEGYAEILRQGVEIVRSMTALPQPII
AMVDGPAIGLGATIALFADICLMAEDARIADPHVGVGVVAGDGGAVIWPLLVGPNRAKEF
LMTGEALTGAEAAEMGLVNHAYSREQLEQETYRLAERLATGPRLAIELTKRSVNLFVSQV
MNTVLTASLAMEGITFQTADHREAVRAFFAKEPPKFGKGQE
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgcggacgagatatcccaagattcatgaggagggacggagggtgtatgaatcgtatgaa
acgttgacgtttgaaaggcgcgggaccattctcaccgtgcgtctgacgaatcccgggtct
cgcaattcggtcaatcaaaagatgcatgaggaattgagccgggttttcgtggatatctcc
agagatcgggaaacccgcattgtggttttgcggggagcggaagagggacgggcgttttgt
gcggggggtgatctgcactggcttgaaacagaagcgcgcacgccggaaggatatgcggag
atccttcgccaaggcgtggaaatcgttcggtcgatgacagccctgccgcaacccatcatc
gccatggtggatggccccgccattgggttgggagccacgattgcgctgtttgcagatatc
tgcctcatggcggaggatgcgcgaatcgccgatccgcatgtgggtgtcggtgtggttgcc
ggagacggcggggcggtgatttggccgttgttggtggggcccaatcgggcgaaagagttc
ttgatgaccggagaggcgctcaccggggcggaggcggcggagatggggttggtcaatcat
gcgtactcccgggaacagttggagcaggaaacgtaccggctggcggagcgcttggccacg
ggcccgcggctggccattgaattgaccaaacggtcggtaaatctctttgtgtcccaagtc
atgaacaccgttttgaccgcctccttggctatggaagggatcacgttccaaacggccgac
catcgtgaagccgtgcgggcgttttttgcgaaagagcctccgaagtttggaaaaggacaa
gaatga

DBGET integrated database retrieval system