KEGG   Kyrpidia tusciae: Btus_2453Help
Entry
Btus_2453         CDS       T01220                                 

Definition
helicase, RecD/TraA family (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bts  Kyrpidia tusciae
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bts00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Btus_2453
Enzymes [BR:bts01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Btus_2453
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2474346..2476571)
Genome map
AA seq 741 aa AA seqDB search
MNGEDRLARPEAEEVTASGTVERVVFRNEETGFAVFRLKTSEGVISCTGHVYFSQGEGEA
LEVTGHWAEHPRYGRQLQVTGWNKPLPTDREVAIQLFRRLEGVGRRLARRIVAALGPGAV
GAILDHGEAALAGIQGLSPEKAQSIVKQVRAHHGVQKVLGQLMALGISPGAAMRVYRVLG
EGCLEDIRRNPYLLAGVAGIGFGQADGVARRLGISTDSPFRLQSALLHTLAGSTTEGHCW
LDRAFWLAKTAEMLAGMDGEPWEADRFEGAAGTLAREGQIRQEEDRVYLASLWEAEEQVA
RWAADRLRVAALQSAGLDDLIQSYERESGVTLSLTQREAVRTAMASPLLILTGGPGTGKT
TTVRAILWCRQQLNPQTKVGMAAPTGRAARRLEEVSGFPAATVHRLLGMRVEGIAQFDEE
NPLPYDLIIVDETSMMDILLADKLVRAAGDAGVILVGDVDQLPSVGPGHVLHDLIQAGVP
SVRLDVIFRQARESNIVVNAHRVLQGELPRQGGDFWFVEVSGATTAETNGAIAVRLEQAV
QNLLAEGYSPADIQVLSPTKKGELGTEALNIRLQQLMNPRQRGKKEIPFGRKGERAWRVG
DKVIQMRNDYEKEVFNGEIGLIEDVDPEEGVLLIRFGDALHEYERDEWDQVRHAYAITIH
KSQGGEYPVVLIPMTTSHYILLYRNLLYTGITRAKKLCGLIGMPRALGLAVRNTRPVLRN
TRLTEKIQVYSRGRGADPGDP
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
ttgaacggagaggatcgattggcccgcccggaagccgaggaggtgaccgcttccggtacg
gtggagcgggtggtcttccgaaatgaagagacgggatttgccgtgttccgcctgaaaacc
tccgagggcgtgatcagttgtacggggcatgtatatttttcccaaggcgaaggggaggcc
ctggaagtgacgggtcactgggcggagcatccgcgctacggccggcaacttcaggttacg
ggatggaataaaccgctgcccaccgaccgagaggtggccatccagttgttccggcggctg
gagggggtgggcaggcgattggcccgaaggattgtcgccgccctcggccccggggcggtg
ggcgcgatcctcgatcacggggaggcagccttggcggggattcaagggttgtcgccggag
aaggcgcagtcgatcgttaagcaggttcgggcgcatcacggggtccagaaggtgctgggg
caattgatggccctgggcattagcccgggtgccgccatgcgggtataccgggtgttgggg
gaagggtgcctcgaggatatccggcgtaatccgtatcttttggcgggggtggccggcatc
gggtttggccaggcggacggggtcgcccggaggttgggcatctcgaccgacagtccgttt
cgccttcaaagtgcgctgttgcataccctggcgggctcaaccaccgaaggccactgttgg
ttagaccgggccttttggctggcgaaaacggcggagatgctggccggcatggacggtgag
ccgtgggaggccgatcggttcgagggagccgccgggaccttggcgcgggaggggcaaatc
cggcaagaagaggatcgggtctatctggcgtctttgtgggaagccgaggaacaggtggcc
cggtgggcggcggaccggctccgggtggccgctctgcagtcggccgggctggatgatttg
atccagtcctacgagcgggagtccggggtgaccctgtcgctcacccagcgggaagcggtt
cgaacggccatggccagtcctctcttgattctgaccggcgggccggggaccggaaagacc
acgacggttcgggcgatcctgtggtgccggcaacaattgaacccccagaccaaggtgggc
atggcggcgcccacgggccgggccgcccgaaggctggaagaagtctcgggatttccggct
gccacggtgcaccggctcttaggcatgcgggtggaaggaatcgcccagtttgacgaggag
aatcccctcccgtatgatctgattatcgtcgatgagacgtcgatgatggatatcctgctg
gcggacaaattggtccgggccgccggggacgccggggtgattctggtcggggatgtggac
cagttgccgtcggtgggtccgggacatgtgttgcacgacctgattcaggccggagtgccc
agcgtccggctcgatgtgattttccgacaggccagggagagcaacatcgtggtcaatgcc
caccgggtgctccaaggggagttgccccgccagggcggggacttttggtttgtcgaggta
tccggggccacgacggctgaaacgaatggggccatcgccgttcgtctggagcaggcggtg
caaaatctcctggcggagggttactcgcccgccgatatccaggtgctgagtcccaccaaa
aagggggagcttggcaccgaggcgttgaacattcgactgcagcagctgatgaacccccgg
caaaggggcaaaaaggaaatccccttcggtcgcaagggcgagcgggcctggcgggtgggc
gacaaagtgatacagatgcgcaacgattatgagaaagaggtgtttaacggcgaaatcggc
ctgatcgaagacgtggaccccgaggaaggggtgctgctgattcgattcggcgacgccctt
cacgaatacgagcgggacgagtgggatcaggtgcgccacgcctatgccattacgattcac
aaaagccagggcggcgaatatcccgtggtgctgatccccatgaccacgagccattacatt
ttgctgtaccgaaacctgctttacacggggatcacccgggcaaagaagctctgtgggttg
atcggcatgccccgggccctgggcctggcggtgcgcaacacccggccggtgttgcgcaac
acccggctgaccgagaagattcaagtatacagcagggggcgaggggcagatccgggggat
ccgtga

DBGET integrated database retrieval system