KEGG   Kyrpidia tusciae: Btus_2794Help
Entry
Btus_2794         CDS       T01220                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
bts  Kyrpidia tusciae
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bts00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2866695..2867363)
Genome map
AA seq 222 aa AA seqDB search
MDKVSRAKTELIQASRALRDAGLMFRGYHANLSARISEDEMILTKGGNVAHLDEDSFAVV
RIDGTVLEGEVAPAQAEIIQMHAAVYRERASVGSVIHTHAPHATVFAVAHQPIPIVYEPL
VRFGVTDAIPVVPWAPRGSDASVNGIIDIVRGHPGVSAVLLANHGVLVFSRTPAEAVQLL
ATLDEAAELILNARLIGGEKRLPNEAFEQIEQRMREFAGAEK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggataaagtctctcgggctaaaaccgagttgattcaagcgtctcgggcgttgcgagat
gcaggcttgatgtttcgcgggtatcatgccaacttgtcggcacggatctccgaagatgag
atgatcttgacaaagggcggcaatgttgcccatctcgacgaggacagttttgcagtggtt
cgcatcgacggcactgtccttgagggagaagttgccccagcccaagcggagattatccag
atgcatgccgcggtctatcgcgagcgtgcttcggtcggcagcgtcatccatacccatgcg
cctcacgccacagtctttgccgtcgcccatcaaccgatcccgattgtttacgaacccttg
gtccgcttcggagtgaccgacgccattccggtcgtaccatgggcgccgcgggggtcggac
gcttcggtaaacggcattatcgatattgtgaggggacatccgggggtatcggcggtgctc
ttagcgaatcacggcgtgctcgtgttttcgcgtacccctgctgaagcggttcagttgctg
gccactctcgatgaggcagccgaattgattttgaacgcgcggttgatcggcggagaaaag
cgcctgcccaatgaggcctttgaacagattgaacagcggatgcgagaattcgctggtgcc
gagaagtaa

DBGET integrated database retrieval system