KEGG   Kyrpidia tusciae: Btus_2894Help
Entry
Btus_2894         CDS       T01220                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
bts  Kyrpidia tusciae
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bts01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:bts00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2974984..2976273
Genome map
AA seq 429 aa AA seqDB search
MIEFIKRESSTSGQERSSVTETVAEILSHVRDRGDEALRYYAKKFDGVEVSDLKVSIHEI
ERAVHQLPLTLWEDIQYSIGRIRSFAEAQMESLAEFEKEMIPGVHLGQRVIPVETVGAYV
PGGRYPLLSAAQMSIIPAKVAGVKEVRVCTPPTKDGGIHPAVLCAAYLSGADEIFRVGGA
QAIGALAYGTETIRPVCKISGPGNRYVTEAKRQVYGVVGIDLLAGPSEVLVLADETARPE
YVATDLLAQAEHDMDARAILVTTSRRLASAVLQEIDRQLRTLGTAEIAGASWSRKGQVIV
ADTLDEAIQITNDLAPEHLHVQIENSRDYLDRFTNYGSLFLGEKSSVVFADKLSGTNHIL
PTLGAAKYTGGVWVGTFLKVVTYQWIEDEGVAALAPPCVRQSHREGLLAHMRSANIRLTG
ELDSYQPVS
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaattcatcaaacgagaatcctcaacctcgggccaggaacgatcttccgtaacc
gaaactgtcgcagagatcttgagccacgtgcgtgaccgtggagacgaagcccttaggtac
tatgccaaaaagttcgacggagtcgaagtcagcgatctaaaagtttccatccacgaaatc
gaacgggccgttcaccaattgccgctcactctctgggaagacatccaatattccatcggg
cgcatccgctcctttgcggaagctcaaatggaaagtctggcggaattcgagaaggaaatg
atccccggcgttcatctcgggcaacgggtcatcccggtggaaacggtcggcgcctacgtg
cccggcggccgctatcccctcctgtcggcggcccagatgtccattatccccgccaaggtg
gcgggcgtcaaagaagtccgggtgtgcacgcctcccacaaaggacggcggcatccatccg
gcagtcctgtgtgcagcatacttgtcgggcgccgacgaaatttttcgcgtcggcggagcc
caagcgatcggcgcattagcttacggcacggagacgatccggcccgtgtgtaaaatttcc
ggccccggcaaccggtacgttaccgaagccaaacggcaggtctacggcgtggtgggcatt
gatctcttggccggcccgagcgaggttttggtgctcgccgacgagaccgcccggcccgaa
tacgtcgcaaccgaccttctggctcaagccgagcacgacatggatgccagggccattctt
gtgacgaccagccggcgcctggcttccgccgtattgcaagaaatcgaccggcaacttcgt
actttgggtaccgccgagatcgccggggcgtcgtggtcgagaaaaggccaggtcattgtg
gcggacaccctggatgaagcgattcagatcaccaatgatcttgccccggaacaccttcac
gtgcaaatcgagaattcgcgggattacctggatcgcttcaccaattacggctccctgttt
ctcggcgaaaagtcttcggtggtcttcgcggacaagctcagtggcactaaccatatcctg
cctaccttgggagccgccaaatataccggtggggtttgggtcgggacgtttttgaaagtc
gtcacctaccaatggattgaagacgagggcgttgccgccctggcccccccgtgcgtgcgt
caatctcatcgggaaggattgctggctcacatgcgttcggccaatatccgcctgaccggt
gaattggattcgtatcaaccggtgagctga

DBGET integrated database retrieval system