KEGG   Kyrpidia tusciae: Btus_2894Help
Entry
Btus_2894         CDS       T01220                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
bts  Kyrpidia tusciae
Pathway
bts00340  Histidine metabolism
bts01100  Metabolic pathways
bts01110  Biosynthesis of secondary metabolites
bts01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bts00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Btus_2894
Enzymes [BR:bts01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Btus_2894
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh Imm21
Motif
Other DBs
NCBI-ProteinID: ADG07531
JGI: Btus_2894
UniProt: D5WVI8
Position
2974984..2976273
Genome map
AA seq 429 aa AA seqDB search
MIEFIKRESSTSGQERSSVTETVAEILSHVRDRGDEALRYYAKKFDGVEVSDLKVSIHEI
ERAVHQLPLTLWEDIQYSIGRIRSFAEAQMESLAEFEKEMIPGVHLGQRVIPVETVGAYV
PGGRYPLLSAAQMSIIPAKVAGVKEVRVCTPPTKDGGIHPAVLCAAYLSGADEIFRVGGA
QAIGALAYGTETIRPVCKISGPGNRYVTEAKRQVYGVVGIDLLAGPSEVLVLADETARPE
YVATDLLAQAEHDMDARAILVTTSRRLASAVLQEIDRQLRTLGTAEIAGASWSRKGQVIV
ADTLDEAIQITNDLAPEHLHVQIENSRDYLDRFTNYGSLFLGEKSSVVFADKLSGTNHIL
PTLGAAKYTGGVWVGTFLKVVTYQWIEDEGVAALAPPCVRQSHREGLLAHMRSANIRLTG
ELDSYQPVS
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaattcatcaaacgagaatcctcaacctcgggccaggaacgatcttccgtaacc
gaaactgtcgcagagatcttgagccacgtgcgtgaccgtggagacgaagcccttaggtac
tatgccaaaaagttcgacggagtcgaagtcagcgatctaaaagtttccatccacgaaatc
gaacgggccgttcaccaattgccgctcactctctgggaagacatccaatattccatcggg
cgcatccgctcctttgcggaagctcaaatggaaagtctggcggaattcgagaaggaaatg
atccccggcgttcatctcgggcaacgggtcatcccggtggaaacggtcggcgcctacgtg
cccggcggccgctatcccctcctgtcggcggcccagatgtccattatccccgccaaggtg
gcgggcgtcaaagaagtccgggtgtgcacgcctcccacaaaggacggcggcatccatccg
gcagtcctgtgtgcagcatacttgtcgggcgccgacgaaatttttcgcgtcggcggagcc
caagcgatcggcgcattagcttacggcacggagacgatccggcccgtgtgtaaaatttcc
ggccccggcaaccggtacgttaccgaagccaaacggcaggtctacggcgtggtgggcatt
gatctcttggccggcccgagcgaggttttggtgctcgccgacgagaccgcccggcccgaa
tacgtcgcaaccgaccttctggctcaagccgagcacgacatggatgccagggccattctt
gtgacgaccagccggcgcctggcttccgccgtattgcaagaaatcgaccggcaacttcgt
actttgggtaccgccgagatcgccggggcgtcgtggtcgagaaaaggccaggtcattgtg
gcggacaccctggatgaagcgattcagatcaccaatgatcttgccccggaacaccttcac
gtgcaaatcgagaattcgcgggattacctggatcgcttcaccaattacggctccctgttt
ctcggcgaaaagtcttcggtggtcttcgcggacaagctcagtggcactaaccatatcctg
cctaccttgggagccgccaaatataccggtggggtttgggtcgggacgtttttgaaagtc
gtcacctaccaatggattgaagacgagggcgttgccgccctggcccccccgtgcgtgcgt
caatctcatcgggaaggattgctggctcacatgcgttcggccaatatccgcctgaccggt
gaattggattcgtatcaaccggtgagctga

DBGET integrated database retrieval system