KEGG   Kyrpidia tusciae: Btus_3136Help
Entry
Btus_3136         CDS       T01220                                 

Definition
(GenBank) peptidase M42 family protein
Organism
bts  Kyrpidia tusciae
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3203042..3204121
Genome map
AA seq 359 aa AA seqDB search
MNNWQGIDSFLELLALDGPSGHEDAVAIWLSHWFKAAGLTVEQDALGNLIARRPAADPGD
DRPPTVLITAHMDEIGLMVSHIEAGGFLRFVPIGGVDPRTLPSAEVTVHGRKPLLGVIGS
KPPHLSTPEERKEAAGTERMFIDLGLPELEVREWVRPGDPVTIRRRPLRLLDDRIAAKSV
DNRASVAAVFECIAQLSSHPLQVDVVFAATVQEEVGMRGAATAAYQIRPDLAVAVDVCHA
RSPGVSTERTMGMGDGPAIQFGPNIHPALFRSLTAATQAAGLPYQVLVAQGATGTDARLM
QLCREGIPTAALGIPIRYMHTSVETVQYQDIRRTGQLLAGWLKSLNRSVVEGFLCYFDV
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaactggcaaggcattgattcttttctggaactgctggccctcgatggcccctcc
ggccacgaagacgccgtcgcaatatggctcagccactggttcaaggccgcgggactgaca
gtggaacaagacgccttgggaaatctcatcgcccgaaggcccgctgctgatccgggcgat
gaccggccccccaccgtcctcatcaccgcccacatggatgaaatcggcctcatggtctcg
cacatcgaagccgggggcttcctccgcttcgtccccatcgggggcgtggatccgcggact
ttgccttccgccgaggtcacggttcacggacgcaaacccctgctgggtgtcatcggcagc
aaaccgccccacctcagcacccccgaggagcgaaaagaagcggcggggacggagcggatg
ttcatcgacctcgggctgccggaattggaagtgcgggagtgggtgcgccccggggatccg
gtgacgattcgccggcgccccctgcggcttctggacgaccgcatcgccgcaaaatctgtg
gacaaccgggcctcggtggcggcggttttcgagtgcatcgcccagctgtcttctcatccg
ctccaagttgacgtggtttttgccgcgacggtgcaggaagaagtcggaatgcggggcgcg
gcgacggcggcctatcagatccggccggatctggctgtggcggtggatgtgtgccacgcc
cggtccccgggggtgtcgacggagcgcaccatgggcatgggggacggccccgcgatccag
tttggccccaacatccacccggccctgttccggtccctcaccgccgcgacccaggccgcg
ggcttgccttatcaagttctcgtcgcccaaggagccacggggaccgacgcccgactgatg
cagctgtgccgggaagggatacccaccgcggccctggggatcccgatccgttacatgcac
acctcggtggagacggtgcagtaccaagacatccgccggacggggcaacttttggcggga
tggctgaagagcctgaaccgcagcgttgtggagggatttttgtgttacttcgacgtttaa

DBGET integrated database retrieval system