KEGG   Kyrpidia tusciae: Btus_3137Help
Entry
Btus_3137         CDS       T01220                                 

Definition
(GenBank) Cellulase
Organism
bts  Kyrpidia tusciae
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3204103..3205299
Genome map
AA seq 398 aa AA seqDB search
MLLRRLSETPGPSGFEDQVRHVLIEELRPHARRIYTDALGNLFVETGPEQGGPRVMLAAH
MDEVALMIVRIDDEGTLRFRAIGGIDERVLVSKAVRVGPAGLPGVIGSKAVHLQKPEERK
RPVAIEDLYIDIGAKDADQASGRVHVGDYAVFATEYEQIGQGKAKGKAFDDRVGCAVLAE
LAKRSFQLPTTFVFTVQEEIGLRGAGPAAYRVNPDLAFVIEGTLCFDVPDARDEDSVTIQ
GRGPAISLLDRATIPPQSLIRWMAEVADAREIPYQWRRSGAGGNDAGAIHLTRRGIPTGA
ISVPVRYIHSPAQIVDLADYENTIALTEALLRDLEDHPDRLDGLRLANRVYPPAAPGSGP
SPGAPPHPGRPGPEPPPASGKGPEGNKTAAEEEGEQEP
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
gtgttacttcgacgtttaagcgaaacccctggcccttcgggatttgaagaccaagtgaga
cacgttctcatcgaagagctgcgcccccacgcccggcggatctacactgatgctttggga
aatttattcgtggaaaccggccccgaacagggaggtccccgggtgatgttggccgcccac
atggatgaagtcgccctgatgatcgtccgcatcgatgacgaaggcacccttcggttccgg
gccatcggcggtatcgacgagcgggtgttggtgtccaaagccgttcgggtgggccccgcc
ggcctcccgggggtgatcggctccaaggccgtgcatttgcaaaaacccgaggaacgcaaa
cgccccgtcgccattgaggatctgtacatcgacatcggcgccaaagacgccgatcaagca
tcgggccgggtgcacgtcggcgactacgcggtattcgccaccgagtacgaacagatcggg
cagggcaaagccaaaggcaaagcattcgatgaccgggtggggtgtgcggtcctcgccgaa
ctggcgaaacggtcctttcagcttccgaccacctttgtcttcaccgtccaggaggagatc
ggcctgcggggggcaggcccggccgcttatcgcgtcaatcccgacctcgccttcgtgatc
gagggcaccctttgttttgatgttcccgacgcccgggacgaggacagcgtcaccatccag
ggacgagggccggccatcagcctcctcgatcgcgccaccatccctccccaatccctcatc
cggtggatggcggaggtggccgacgcccgggaaatcccgtaccagtggcgacgctcgggc
gccgggggcaatgacgccggagcgatccacctgacccgccggggcatccccaccggagcc
atctcggtgccggtgcgctacattcacagtccggcacagatcgtggacctggcggattac
gagaacaccatcgccctgaccgaggccctgcttcgggatctggaagaccatccggaccgg
ctggatggtttgcgactcgcaaatcgggtctatccgccggccgcaccgggcagcgggccg
tccccgggtgcacccccgcacccgggccgcccgggcccagaaccccctccggcctctgga
aagggcccggaggggaacaagaccgccgccgaggaggaaggagagcaagaaccatga

DBGET integrated database retrieval system