KEGG   Kyrpidia tusciae: Btus_3216Help
Entry
Btus_3216         CDS       T01220                                 

Definition
(GenBank) UDP-N-acetylglucosamine1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bts  Kyrpidia tusciae
Pathway
bts00520  Amino sugar and nucleotide sugar metabolism
bts00550  Peptidoglycan biosynthesis
bts01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bts00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Btus_3216
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Btus_3216
Enzymes [BR:bts01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Btus_3216
Peptidoglycan biosynthesis and degradation proteins [BR:bts01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   Btus_3216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase
Motif
Other DBs
NCBI-ProteinID: ADG07824
JGI: Btus_3216
UniProt: D5WX43
Position
complement(3284220..3285482)
Genome map
AA seq 420 aa AA seqDB search
MATILVQGGRPLKGTVRVSGAKNASLPILAASLLAVEGRCVVEDVPILRDVDCMCDMIQA
LGVDVQREPGGVVRLNAEEVSHTEAPYELVRRMRASFVVMGPLLARFGHARVALPGGCAI
GARPVDQHIKGFEALGADVTVEHGYVEARAPRGRLRGNRVYLDIPSVGATQNIMMAAALA
DGLTIIENAAKEPEIVDLANFINKMGGRVRGAGTDVIRVEGVDRLRGVEHTVIPDRIEAG
TFLLAGAITGGEIYVEGAISTHLKPLLAKLKETGVHVEDDVNGIFVAGGPGQRALDIKTH
YYPGFPTDMQAQIMALLTIIPGSSMVTETVFENRFMHVAELQRMGADIRVEGRTAVIEGV
PKLTGARVNSTDLRAGAALLLAGLAAEGETEVHGVHHIDRGYVDIVGKLHALGAAIKRVE
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
ttggcgaccattctcgtgcaaggcggtcgaccccttaaggggacggtcagggtaagcggg
gcgaaaaacgcctcccttcccattctggcggcgtcgctgttggccgtggagggccggtgc
gtggtggaagatgtaccgatcctccgggacgtcgattgcatgtgtgacatgatccaggcg
cttggggtcgatgtccagcgcgagcctggaggcgtggtccggctcaatgccgaggaggtt
tcccacacggaagctccttacgagttggttcgccggatgcgcgcctcctttgttgtgatg
ggtccgctcctcgcccggtttggacatgcccgggtggccctgcccggcgggtgcgccatc
ggggccaggccggtggatcagcatattaagggattcgaagccctgggtgccgatgtcacc
gtggagcacggctatgtcgaggcccgggccccccggggtcgcctgcggggcaatcgcgtg
tatctcgacatcccaagcgttggagcgacccaaaacatcatgatggcggccgccctggca
gacgggctgacgatcatcgagaatgcggccaaagaaccggagattgttgacctggccaat
tttatcaacaaaatgggcggccgggtccggggggccggcacggacgtcatccgggtggag
ggcgtggatcggttgcggggggtggagcacacggtgatccccgatcgaatcgaagccggc
acctttttgttggccggtgccattaccggcggagagatctatgttgagggcgccatcagc
acgcacttaaagcccttattggcgaagctcaaagaaacgggggttcacgtcgaggacgat
gtgaacgggatttttgtggcggggggccccggacagcgcgccctggacatcaagacgcac
tattatcccggtttccccacagacatgcaggcgcagatcatggcgctgctcacaatcatt
cccgggagcagcatggtgacggaaacggtgtttgagaaccgcttcatgcacgtggccgag
ctccagcgcatgggggcggacatccgggtggaagggcggactgcagtgatcgaaggggtg
ccgaaactcaccggcgcccgggtgaattcgacagacctgcgagcgggtgccgccctgctg
ttggcgggcctggccgctgaaggggaaacagaagtgcacggcgttcaccatatcgaccga
ggatacgtagatatcgtcgggaagctccacgccctcggggcggcgatcaagcgggtggag
tga

DBGET integrated database retrieval system