KEGG   Bacillus thuringiensis serovar kurstaki HD73: HD73_0154Help
Entry
HD73_0154         CDS       T02460                                 

Definition
(GenBank) arginase
  KO
K01476  
arginase [EC:3.5.3.1]
Organism
btt  Bacillus thuringiensis serovar kurstaki HD73
Pathway
Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:btt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HD73_0154
  Amino acid metabolism
   00220 Arginine biosynthesis
    HD73_0154
   00330 Arginine and proline metabolism
    HD73_0154
Enzymes [BR:btt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     HD73_0154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
152617..153510
Genome map
AA seq 297 aa AA seqDB search
MKKEISVIGVPMDLGQMRRGVDMGPSAIRYAGVIERIEEIGYDVKDMGDICIEREKEIDE
NTKLRNLTQVATVCNELASKVDHIIEEGRFPLVLGGDHSIAIGTLAGVAKHYKNLGVIWY
DAHGDLNTEETSPSGNIHGMSLAASLGYGHSSLVDLYGAYPKVKKENVVIIGARALDEGE
KDFIRNEGIKVFSMHEIDRMGMTAVMEETIAYLSHTDGVHLSLDLDGLDPHDAPGVGTPV
IGGLSYRESHLAMEMLAEADIITSAEFVEVNTILDERNRTATTAVALMGSLFGEKLK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaggaaatctcagttattggagttccaatggatttaggacagatgcgtcgtgga
gttgatatgggaccgagcgcgatccgttatgcaggggtaattgaaagaattgaagaaatt
ggatatgacgttaaagatatgggagatatatgtatagagagagaaaaagagatagatgaa
aatacaaaattaagaaaccttacacaagttgcaactgtatgtaatgaattagcaagtaag
gtggatcatattatagaagaaggtcgttttccacttgtattaggtggtgaccatagtatt
gctatcggtacattagctggtgtagcaaaacattataaaaacttaggcgttatttggtat
gatgcacacggtgatttaaatacagaggaaacttcaccatctggaaatattcatggtatg
tcacttgcagcaagtttaggttatggacattcttcacttgtagatttatacggagcatat
ccaaaggtgaaaaaagagaatgtcgtaattatcggtgcgcgtgcattggatgaaggagaa
aaagatttcattcgcaatgaaggtattaaagtgttctcaatgcatgaaattgatcgtatg
gggatgacggctgttatggaagaaacaatcgcatatttatctcatactgatggtgtacac
ttatcattagatttagacggtcttgatcctcatgatgcaccaggtgttggaacgcctgta
attggcggtctatcttatcgtgaaagtcatttggcgatggaaatgttagcagaagctgat
attatcacatctgctgaatttgttgaggtaaatacgattttagatgagagaaatagaacg
gcaacaacagcagttgctttaatgggttctttattcggtgaaaaactaaaataa

DBGET integrated database retrieval system