KEGG   Bacillus thuringiensis serovar kurstaki HD73: HD73_0462Help
Entry
HD73_0462         CDS       T02460                                 

Definition
Class II aldolase/adducin
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
btt  Bacillus thuringiensis serovar kurstaki HD73
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:btt00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
453202..453843
Genome map
AA seq 213 aa AA seqDB search
MLLQKEREEIVAYGKKMISSGLTKGTGGNISIFNREQGLVAISPSGLEYYETKPEDVVIL
NLDGEVIEGERKPSSELDMHLIYYRKREDINALVHTHSPYAKTIASLGWELPAVSYLIAF
AGPNVRCAPYETFGTKQLADAAFEGMIDRRAVLLANHGLIAGANNIKMAFTVAEEIEFCA
QIYYQTKSIGEPKLLPEDEMENLAKKFEGYGQQ
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgttattacaaaaagaaagagaagaaattgtagcgtatggaaagaaaatgatttctagt
ggtttaacaaaggggacgggtggtaatattagtatctttaatcgtgaacaaggtcttgtt
gcgattagcccaagtggtttagagtactatgaaacaaagcctgaagatgtagttatatta
aacctagatggtgaagtaatagaaggagagagaaaaccatcaagtgaattagatatgcac
cttatttactataggaagcgtgaagatataaatgcgcttgtgcatacacattctccttac
gcgaagacgattgcgtcattaggatgggagcttccggctgtgtcatatttaattgctttt
gcaggtccgaatgtccgctgtgcgccgtatgaaacatttggtacgaagcaattagcggat
gctgcttttgaaggcatgattgatcgtcgtgctgtgctacttgcaaatcacggtttaatt
gctggtgcaaataatataaaaatggcatttactgttgcagaagagattgagttttgtgct
caaatttattatcaaacgaaaagcattggggaaccaaagctattgccagaagatgagatg
gagaatttggcgaagaagtttgaagggtatgggcaacagtag

DBGET integrated database retrieval system