KEGG   Bacillus thuringiensis serovar kurstaki HD73: HD73_1290Help
Entry
HD73_1290         CDS       T02460                                 

Definition
(RefSeq) isocitrate lyase
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
btt  Bacillus thuringiensis serovar kurstaki HD73
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:btt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HD73_1290
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    HD73_1290
Enzymes [BR:btt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     HD73_1290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
1261991..1263268
Genome map
AA seq 425 aa AA seqDB search
MKNERIEKLQESWELDERWKGITRPYSAEDVIRLRGSIDIEHTLARRGAEKLWTSLHTED
YINALGALTGNQAMQQVKAGLKAIYLSGWQVAADANLSGHMYPDQSLYPANSVPAVVKRI
NQTLQRADQIQHMEGSDDTDYFVPIVADAEAGFGGQLNVFELMKGMIEAGASGVHFEDQL
SSEKKCGHLGGKVLLPTQTAVRNLISARLAADVMGVPTIIVARTDADAADLITSDIDPVD
KAFITGERTPEGFYRTNAGLDQAIARGLAYAPYADLVWCETSEPNLEDAKRFADAIHKEH
PGKLLAYNCSPSFNWKQKLDEKTIASFQKEIASYGYKFQFVTLAGFHSLNYGMFELARGY
KERGMAAYSELQQAEFAAEKHGYSATRHQREVGTGYFDEVAQVITGGTSSTTALKGSTEE
AQFTK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgaaagaatcgagaagttacaagaaagctgggaattagatgagcgttggaaa
gggatcacacgtccatattcggcagaagatgtaattcgcctgcgcgggtcaattgatatt
gaacatacgttagcgcgtcgtggtgctgagaagctttggacatcgcttcatacagaagac
tatattaacgcacttggcgcattaacaggaaaccaagcgatgcaacaagtaaaagctggg
ttaaaagcgatttacttaagtggttggcaagtagcagctgatgcaaacctttctgggcat
atgtatccagaccaaagtttatatccagcgaacagcgtacctgctgtagtaaaacgaatt
aatcaaacgcttcaacgtgcggatcaaattcagcatatggaaggaagcgatgatacagac
tatttcgtaccgattgtagcagatgcagaagctggatttggtgggcaattaaatgtattc
gaactgatgaaaggtatgattgaagcaggtgcatcaggtgtgcattttgaagatcaatta
tcttcagagaaaaaatgtggccatttaggcggaaaagtattactaccaacgcaaacagca
gtacgcaatttaatttctgcacgccttgcagcagatgtaatgggagtgccgacaattatc
gttgcaagaacagatgcggatgcagctgatttaattacgagcgatattgatcctgttgat
aaagcatttattacaggagaaagaacaccagaaggattttaccgtacaaatgcaggtctt
gatcaagcaattgcgcgcggtttagcgtatgcaccgtacgcagacctcgtttggtgtgaa
acgtcagaaccgaatttagaagatgcaaaacgatttgcggacgcaattcataaggagcat
ccagggaagctacttgcatataactgctcaccttcatttaactggaaacaaaaactagat
gaaaaaacaattgcaagcttccaaaaggaaatcgcatcttacggttacaagttccaattc
gtaacacttgctggattccattcattaaattacggtatgtttgaactagcacgtggctat
aaagagcgcggcatggcagcatactctgaactacaacaagcagaattcgcagctgaaaaa
catggctactctgcaacacgtcatcaacgcgaagtaggaacaggttactttgatgaagtg
gcacaagtgattacaggcggaacttcatcaacgacagcgttaaaaggatctacggaagaa
gcacagtttacgaaataa

DBGET integrated database retrieval system