KEGG   Bacillus thuringiensis serovar kurstaki HD73: HD73_1444Help
Entry
HD73_1444         CDS       T02460                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
btt  Bacillus thuringiensis serovar kurstaki HD73
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:btt00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:btt00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1394835..1395380
Genome map
AA seq 181 aa AA seqDB search
MKVVETNFTDAKLLEPRLFGDERGFFSESYNKQVLETLGITYSFVQDNVSYSAKAGTIRG
LHFQKKPKAQTKLIQVMQGAIYDVIVDLRKKSPTFKQWKGYILSADNHRQLLVPKGFAHG
FCTLVPHTIVMYKVDEYYSAEHDSGLLWEDKDLAIPWPVTDPILSDKDQILPLLEEYEDS
F
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttgtagaaacaaattttaccgatgcaaaattgttagaaccgaggttgtttgga
gacgagcgtggctttttttcagagagttataataagcaggtgctagaaacattagggata
acgtattcatttgtacaggataacgtatcttattcggctaaggcaggaacgattcgggga
ctacactttcaaaaaaaaccgaaagcacaaacgaaactcattcaagttatgcaaggggca
atttatgatgttatcgttgatttacgaaaaaaatcaccaacatttaaacaatggaaagga
tatattttaagtgcagataaccatcggcaattactagtgccaaaagggtttgcgcatgga
ttttgcacgcttgttccgcatactatcgttatgtataaagtagatgaatattatagcgca
gagcatgactcaggattactttgggaagataaagatttagcaattccttggccagtaacc
gatcctatattgtccgataaggatcagatattaccattattagaggaatatgaagatagt
ttttaa

DBGET integrated database retrieval system