KEGG   Bacillus thuringiensis serovar kurstaki HD73: HD73_1636Help
Entry
HD73_1636         CDS       T02460                                 

Definition
Histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
btt  Bacillus thuringiensis serovar kurstaki HD73
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:btt01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:btt00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1566848..1568137
Genome map
AA seq 429 aa AA seqDB search
MEIIYEDFKEALSKIKVLRENANIIEETVQRSVREIIRHVREGNDEALSFYTKKFDGVEM
KDFRVSEEEIQQASMFVENSFLEALKEAKKNIVSYHEKQKKYSIFDCESKGIIRGQLIRP
LENVGVYVPGGTASYPSSVLMNVLPAKLAGVKKIVMVTPPRKGGIDPHIVAAANLAGVDE
IYTIGGAQAIAALAYGTESIPKVDKIVGPGNLYVALAKREVYGIVNIDMIAGPSEIVVVA
DETGNAKYIAADLLSQAEHDERATAICITTNMELAKEVEKEVERQLETLPRSEIARESIN
RNGAIFIVASLEEALKLSNEIAPEHLELHIKEPMNALDYVKHAGSIFLGPYAPEPLGDYL
AGPNHVLPTSGTARFFSPLSVDDFVKKSSFISYTEEALKNVQHHIVELANKEGLHAHARA
IQIRFEEEK
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcatttatgaagactttaaggaggcattatctaaaataaaagtgctaagagaa
aacgctaatataatagaagaaactgttcaaagaagtgtaagagaaatcattagacatgta
agggaaggaaatgatgaggctttatctttctatacaaaaaagtttgatggtgtagagatg
aaagattttcgtgtaagtgaagaagaaatacagcaagcgagtatgtttgtagagaattca
tttttagaagctttaaaagaggcgaagaaaaacattgtttcgtatcacgaaaaacaaaag
aagtattcaatcttcgattgtgaaagtaaaggcataattagagggcagcttattcggcca
ttagaaaatgtaggtgtatatgtaccaggtgggacagcttcatatccttcttcagtatta
atgaatgtattgccggcgaaacttgcaggtgtgaaaaaaattgtaatggtaacaccgccg
aggaaagggggaattgatcctcatatagtagctgctgcaaatcttgcgggagtagatgaa
atttatacgataggtggcgcacaagcaattgctgctttagcatacgggacggaatcgatt
ccgaaagtggataaaatagttggaccgggaaatttgtacgtcgctctagcgaaacgagaa
gtatacgggatagtaaatatcgatatgattgctggtccatcagaaattgtagttgtcgcg
gatgaaacaggtaatgcaaaatatatcgcagcggatttattatcgcaagcagagcatgat
gagagagcaacggcgatttgtattacaacgaatatggaactagctaaagaagtagaaaaa
gaggtagaaagacagttagaaacgttaccaagaagtgaaattgcacgtgaatcaataaat
agaaatggagccatctttatcgttgcttctttagaggaggcactaaagttatcaaatgaa
attgctccagaacatttagagttacatataaaagaaccgatgaatgctctagattatgtg
aaacatgcaggctctattttccttgggccatatgcacctgaaccgctcggggattatttg
gcgggaccgaatcatgtattaccaacgagcggaacggcaagatttttttctccgttatca
gtcgatgatttcgtgaaaaaatcaagttttatttcttatacagaggaagcattaaaaaat
gtacagcatcatattgtagagcttgcaaataaagaagggttacatgcacatgcgagagca
atccaaataaggtttgaggaggaaaaataa

DBGET integrated database retrieval system