KEGG   Bacillus thuringiensis serovar kurstaki HD73: HD73_2388Help
Entry
HD73_2388         CDS       T02460                                 

Definition
Uroporphyrinogen-III C-methyltransferase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
btt  Bacillus thuringiensis serovar kurstaki HD73
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:btt00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2263532..2264956)
Genome map
AA seq 474 aa AA seqDB search
MNGYVYLVGAGPGDEGLITKKAMECLNRADIVLYDRLLNPSFLNYTKETCELIYCGKMPK
NHTMRQEMINAHLLQFAKEGKIVVRLKGGDPSIFGRVGEEAETLASANIPYEIVPGITSS
IAASIYAGIPLTHRDYSNSVTLLTGHAKGPLTDHGKYNSSHNSDTIAYYMGIENLPTICE
NLLQAEKKEDTPVAVIEWGTTGKQRVVTGTLSTIVSIVKNENISNPSMTIIGDVVSLRDQ
IAWKERKPLHEKKVLFASATNKTSSMKQKLQEAGAEIYQIPTFKKVEYTLTLEQINEIFN
VNRLVFCSAESVEILMQSCSKHQKDIRSLQAQLQHMNVATQEKLMQYGLLSKQAEFSSNT
TVYLGRNINRIAVIQEKIGAGSYMMTHEYTIDHRFDEIHSRMLSEFSWDSIVFEGRASID
TFLAEIKRLGFINILTLPFSYTDVPTLYYANKVGFHNVDHQLQETLMKKDMVRQ
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgaacggatatgtatatttagttggtgcaggaccaggtgatgaagggcttattacaaaa
aaagcgatggagtgcttaaatcgtgcagatatcgtcttatatgaccgcttattaaaccct
tcctttcttaattatacaaaagaaacatgtgaacttatttattgcggaaaaatgccaaag
aatcatactatgcgtcaagaaatgattaacgcacacctccttcaatttgcgaaagaagga
aaaatcgtagtccgcttaaaaggcggagatccatctatttttggccgtgttggtgaagaa
gcagaaactttagcatcagcaaatattccatatgaaattgtaccaggtattacatctagc
atcgccgctagtatctatgcaggtattcccctcacccaccgtgactacagtaatagcgtc
actttattaaccggacatgcaaaaggtcctttaaccgaccatggaaaatataattcatct
cacaatagcgacacaattgcctactacatgggtatagaaaacttacctacaatttgtgaa
aacttactacaagcagaaaaaaaagaagatacgccagtagcagtcattgaatggggtaca
actggtaaacagcgcgttgtcacagggacactgtctaccattgtttctattgtcaaaaac
gaaaatatttctaatccttctatgacaattattggtgatgtcgtttccttacgggatcag
atcgcttggaaagaacgtaaaccattacacgagaaaaaagttttatttgcatctgcaacg
aataaaacaagttcaatgaagcaaaagttacaagaagccggtgcagaaatatatcaaatt
cctactttcaaaaaggtagaatacacattaacacttgaacaaatcaatgaaatttttaac
gttaatcgtcttgttttttgttcagctgaaagtgtagaaatattgatgcaatcatgtagt
aaacaccaaaaagatattcgttctttacaagcgcaactacaacatatgaacgttgccact
caagaaaaacttatgcaatatgggctactaagtaaacaagcagagttctcttccaataca
acagtttatttaggacgaaacattaaccgaattgctgttattcaagaaaaaattggtgct
ggttcctatatgatgactcatgagtacacaattgatcatcgcttcgatgaaattcattca
cgtatgctttctgaattctcatgggatagcattgtatttgaaggtcgtgcttctattgat
acgtttctagcagaaataaaacgccttggctttatcaatattcttactctcccattctcg
tataccgacgttccaactttatactatgcaaataaagttgggtttcataacgtagatcat
caattacaagaaactcttatgaagaaagacatggtgagacaatga

DBGET integrated database retrieval system