KEGG   Bacillus thuringiensis serovar kurstaki HD73: HD73_2639Help
Entry
HD73_2639         CDS       T02460                                 

Definition
Protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
btt  Bacillus thuringiensis serovar kurstaki HD73
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:btt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HD73_2639
Enzymes [BR:btt01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     HD73_2639
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2519332..2520723
Genome map
AA seq 463 aa AA seqDB search
MKTVVVIGGGITGLSTMFYLEKLKKDYNIDLNLILIEKAEYLGGKIHSVEEKDFIMESGA
DSIVARNEYVMPLVKDLNLEDEMVYNETGISYIYSENMLHPIPSDTIFGIPMSAQSLFSS
TLVSTKGKIVALKDFITKNKEFTKDTSLALFLESFLGKELVERQIAPVLSGVYSGKLNEL
TMASTLPYLLDYKNKYGSIIKGFEENKKQFQSAGNKKFVSFKGGLSTIINRLEEVLTETV
VKKGAITTAVSKQEDRYEISFVNHETIQADYVVLAAPHDIAQTLLQSNELNEQFNTFKNS
SLISIYLGFDILDEQLPADGTGFIVTENSDLHCDACTWTSRKWKHTSGKQKLLVRMFYKS
TNPVYETIKNYSEEELVRVALYDIEKSLGIKGEPEVVEVTNWKDLMPKYHLEHNQAVQAL
QEKMTNLYPNVYLAGASYYGVGIGACIGNGKNIANEIMATLNK
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagttgttgttatcggtggaggtataacgggactttctactatgttttattta
gaaaaattaaaaaaggattataatatcgatttaaatttaattcttattgagaaagcagag
tatttaggtggtaaaatccatagtgtggaagaaaaggatttcattatggagtcaggagcg
gattcaatcgttgctcgtaatgaatatgttatgccacttgtaaaagatttaaatttagaa
gatgaaatggtatataatgaaacgggtatttcttacatatattctgaaaacatgttacat
ccgattccttctgatactatatttgggataccgatgagcgcccagtctttgtttagcagt
acgctagtctcaacgaaagggaaaatcgtagctttaaaagatttcataacgaaaaataaa
gagtttacgaaagatacatcacttgctctatttttagaaagtttcttagggaaagagtta
gtggaaagacaaattgctcctgtactttcaggcgtatattctggtaaattgaatgagctt
acaatggcatctacattaccgtatttactggattataaaaataagtatggaagtattatt
aaaggttttgaagagaataaaaaacaatttcaatcagcaggaaataaaaaattcgtatca
tttaaaggtggactatctacgataattaatcgcttagaagaagtgctcactgaaactgtc
gtaaaaaaaggtgctataacgacggctgtaagtaaacaagaagatcgatatgagatttct
tttgtaaatcatgaaacaatacaagctgattatgttgttttagcagctccgcatgatata
gcacaaactttattacagtctaatgagttaaatgagcagtttaatacatttaaaaactca
tctcttataagtatttacttaggatttgacatactagatgaacaactaccagctgacggc
acagggtttattgtaacggaaaacagtgatttacattgtgatgcttgtacatggacaagt
cgaaagtggaaacatacatcgggtaaacaaaaattattagtaagaatgttttataagagc
accaatccggtatatgaaacaatcaaaaattatagtgaagaagaattagtacgagtagct
ttatatgatattgaaaagagtctcggaattaaaggtgaaccagaagtagtcgaagttaca
aattggaaagatttaatgccgaaatatcatttagaacataatcaagcggttcaagcattg
caagaaaaaatgacgaatctttatccaaatgtatatttagctggtgcctcatattatggt
gtcggaattggtgcgtgtattggaaatggaaaaaatatagccaatgaaataatggctaca
ttaaataaataa

DBGET integrated database retrieval system