KEGG   Bacillus thuringiensis serovar kurstaki HD73: HD73_2783Help
Entry
HD73_2783         CDS       T02460                                 

Definition
NADPH--cytochrome P450 reductase
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
btt  Bacillus thuringiensis serovar kurstaki HD73
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:btt00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    HD73_2783
  Amino acid metabolism
   00380 Tryptophan metabolism
    HD73_2783
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    HD73_2783
Enzymes [BR:btt01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     HD73_2783
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     HD73_2783
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2688020..2691217
Genome map
AA seq 1065 aa AA seqDB search
MEKKVSAIPQPKTYGPLGNLPLIDKDKPTLSFIKIAEEYGPIFQIQTLSDTIIVVSGHEL
VAEVCDETRFDKSIEGALAKVRAFAGDGLFTSETHEPNWKKAHNILMPTFSQRAMKDYHA
MMVDIAVQLVQKWARLNPNENVDVPEDMTRLTLDTIGLCGFNYRFNSFYRETPHPFITSM
TRALDEAMHQLQRLDIEDKLMWRTKRQFQHDIQSMFSLVDNIIAERKSSGDQEENDLLSR
MLNVQDPETGEKLDDENIRFQIITFLIAGHETTSGLLSFAIYFLLKNPDKLKKAYEEVDR
VLTDPTPTYQQVMKLKYIRMILNESLRLWPTAPAFSLYAKEDTVIGGKYPIKKGEDRISV
LIPQLHRDKDAWGDNVEEFQPERFEELDKVPHHAYKPFGNGQRACIGMQFALHEATLVMG
MLLQHFELIDYQNYQLDVKQTLTLKPGDFKIRILPRKQTISHPTALAPTEDKLKNDEIKQ
HVQKTPSIIGADNLSLLVLYGSDTGVAEGIARELADTASLEGVRTEVVALNDRIGSLPKE
GAVLIVTSSYNGKPPSNAGQFVQWLEELKTDELKGVQYAVFGCGDHNWASTYQRIPRYID
EQMAQKGATRFSKRGEADASGDFEEQLEQWKQSMWSDAMKAFGLELNKNMEKERSTLSLQ
FVSRLGGSPLARTYEAVYASILENRELQSSSSDRSTRHIEVSLPEGATYKEGDHLGVLPV
NSEKNINRILRRFGLNGKDQVILSASGRSINHIPLDSPVSLLDLLSYSVEVQEAATRAQI
REMVTFTACPPHKKELEALLEEGVYHEQILKKRISMLDLLEKYEACEIRFERFLELLPAL
KPRYYSISSSPLVVQNRLSITVGVVNAPAWSGEGTYEGVASNYLAQRHNKDEIICFIRTP
QSNFELPKDPETPIIMVGPGTGIAPFRGFLQARRVQKQKGINLGEAHLYFGCRHPEKDYL
YRTELENDERDGLISLHTAFSRLEGHPKTYVQHLIKQDRINLISLLDNGAHLYICGDGSK
MAPDVEDTLCQAYQEIHEVSEQEARNWLDRVQDEGRYGKDVWAGI
NT seq 3198 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaaaagtatctgccattcctcagccgaaaacatatggaccgctgggtaatctc
ccattaatcgataaagataaaccgaccctatcctttatcaagatagcggaagagtatggt
cccatttttcaaattcaaactttaagtgataccattattgtcgtttccggacatgaactg
gtagcagaagtctgtgacgaaacacggttcgataaaagtatagagggtgctttagcaaaa
gttcgcgcctttgctggagacggattatttacaagcgagactcacgagcctaactggaaa
aaagctcataatattttgatgcctacatttagccaacgggcaatgaaagattaccatgct
atgatggttgatattgctgtacaactcgttcaaaaatgggcacggcttaatccgaatgaa
aacgtggatgttccggaggatatgactcgtcttacgttagatacaattggtctatgtggt
tttaattaccgatttaatagcttttatcgtgagacccctcatccttttattactagcatg
acccgtgctctagatgaggcgatgcaccaattacagcggttagatatagaagacaaactt
atgtggagaacgaaacgtcaatttcagcatgatatccagtctatgttttctttagtagat
aatattattgctgaacgtaaaagtagtggagatcaggaagaaaatgatttactttcccgt
atgttaaatgtacaagatccggaaactggtgaaaaattagatgatgaaaacattcgtttc
caaattatcacttttttaatagctgggcatgagacaacaagtggattgttatcttttgca
atttactttttattaaagaatccggataaattgaaaaaagcctatgaagaagtagaccgt
gttttgacagatcctactccaacataccaacaagttatgaaactgaagtatatacggatg
attttaaatgaatcactgcgtctatggcctaccgctccagcattcagtctctatgcaaaa
gaagatacagtgattggcgggaaatacccaattaagaaaggagaagatcgtatttctgtt
cttattccacagctacatagggataaagatgcatggggagacaatgtggaagaattccaa
cctgaacgatttgaagagctggataaggttcctcatcatgcttataagccatttggaaat
ggccagagagcatgtatcggtatgcaatttgcacttcatgaagccactcttgtaatggga
atgcttcttcaacattttgaattaatcgattatcaaaactatcagctggatgtaaaacaa
acattaacgctaaagcccggtgattttaagattaggattctaccccgaaaacaaactatt
agccatcctactgctcttgcacctacagaggacaagctgaaaaacgatgaaattaagcag
cacgttcagaagacaccttctattattggggccgataatctttcacttcttgttctgtat
ggctcggatacaggggtagcagaaggtattgcaagagaattagcagatacagctagttta
gaaggggttcgaacggaagtggtagctcttaacgatcgaattggaagtttgccaaaagaa
ggagcggtacttattgtgacttcttcttataatggaaaaccgccaagtaatgcagggcag
tttgtgcaatggttggaggaactaaaaacagatgagctaaaaggggttcaatacgcagtt
tttggttgtggagatcataattgggctagtacctatcaacggattccaagatacattgat
gagcagatggctcaaaaaggagcaacaagattttctaaacgcggagaagcagatgcaagt
ggtgattttgaggaacagctcgagcaatggaaacaaagcatgtggtctgatgcgatgaag
gcatttggattggagctcaacaaaaatatggaaaaagagcgcagtactttgagtctgcaa
tttgtcagtcgtcttggaggatctcctcttgcacgaacatatgaagcagtttatgcgtct
atactagaaaatcgtgaactccaatcatccagcagtgatagaagtacacgacatatcgag
gtatccttgccggaaggcgctacatataaagaaggagaccaccttggagtgctgccagtt
aatagcgagaaaaatatcaaccgaattttaagacgctttggattaaatgggaaggatcaa
gttatactgagtgcaagtggacgaagtataaatcacatacctttagacagtcctgttagt
ttattggaccttcttagttatagtgttgaagttcaagaagcagccactcgagcacaaata
cgagaaatggtaacattcacagcatgtcctcctcataaaaaagaattggaagcattatta
gaagaaggagtttaccatgaacaaatactaaagaaacggatttcaatgttggaccttctt
gaaaagtatgaggcttgtgaaatccgatttgaacgctttttagaacttcttcctgcgctc
aaaccgcgttactattctatttcaagctctccactcgttgtacagaatcgtctgagcatt
acggtcggtgttgttaatgcgcctgcatggagtggggaagggacatatgaaggagtcgct
tctaattacttagctcagcgtcataataaagatgagattatctgtttcattcgaacgcca
caatcaaactttgaattacctaaagatccagaaacaccaattattatggttgggccaggt
actggaattgcaccattccgtggattcttgcaagcgcgtcgtgttcaaaagcaaaaaggt
attaacttaggagaagcacatctatattttggttgtcgtcatcctgaaaaagattatctt
tatcgtacagaactagaaaatgatgaaagagatggattaatctctttacacacagctttt
tctcgtctagagggacatccaaaaacatatgtacagcatttaataaaacaagatagaatc
aatttaatttcgttattagataatggagctcatctttatatatgtggtgatggaagtaaa
atggctccggatgtagaagataccctttgtcaagcgtatcaagaaattcatgaagtcagt
gaacaagaagcaagaaattggttggatcgtgtgcaagatgaagggcgatatggaaaagat
gtttgggctggtatatga

DBGET integrated database retrieval system