KEGG   Bacillus thuringiensis serovar kurstaki HD73: HD73_2783Help
Entry
HD73_2783         CDS       T02460                                 

Definition
NADPH--cytochrome P450 reductase
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
btt  Bacillus thuringiensis serovar kurstaki HD73
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:btt00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:btt00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:btt00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2688020..2691217
Genome map
AA seq 1065 aa AA seqDB search
MEKKVSAIPQPKTYGPLGNLPLIDKDKPTLSFIKIAEEYGPIFQIQTLSDTIIVVSGHEL
VAEVCDETRFDKSIEGALAKVRAFAGDGLFTSETHEPNWKKAHNILMPTFSQRAMKDYHA
MMVDIAVQLVQKWARLNPNENVDVPEDMTRLTLDTIGLCGFNYRFNSFYRETPHPFITSM
TRALDEAMHQLQRLDIEDKLMWRTKRQFQHDIQSMFSLVDNIIAERKSSGDQEENDLLSR
MLNVQDPETGEKLDDENIRFQIITFLIAGHETTSGLLSFAIYFLLKNPDKLKKAYEEVDR
VLTDPTPTYQQVMKLKYIRMILNESLRLWPTAPAFSLYAKEDTVIGGKYPIKKGEDRISV
LIPQLHRDKDAWGDNVEEFQPERFEELDKVPHHAYKPFGNGQRACIGMQFALHEATLVMG
MLLQHFELIDYQNYQLDVKQTLTLKPGDFKIRILPRKQTISHPTALAPTEDKLKNDEIKQ
HVQKTPSIIGADNLSLLVLYGSDTGVAEGIARELADTASLEGVRTEVVALNDRIGSLPKE
GAVLIVTSSYNGKPPSNAGQFVQWLEELKTDELKGVQYAVFGCGDHNWASTYQRIPRYID
EQMAQKGATRFSKRGEADASGDFEEQLEQWKQSMWSDAMKAFGLELNKNMEKERSTLSLQ
FVSRLGGSPLARTYEAVYASILENRELQSSSSDRSTRHIEVSLPEGATYKEGDHLGVLPV
NSEKNINRILRRFGLNGKDQVILSASGRSINHIPLDSPVSLLDLLSYSVEVQEAATRAQI
REMVTFTACPPHKKELEALLEEGVYHEQILKKRISMLDLLEKYEACEIRFERFLELLPAL
KPRYYSISSSPLVVQNRLSITVGVVNAPAWSGEGTYEGVASNYLAQRHNKDEIICFIRTP
QSNFELPKDPETPIIMVGPGTGIAPFRGFLQARRVQKQKGINLGEAHLYFGCRHPEKDYL
YRTELENDERDGLISLHTAFSRLEGHPKTYVQHLIKQDRINLISLLDNGAHLYICGDGSK
MAPDVEDTLCQAYQEIHEVSEQEARNWLDRVQDEGRYGKDVWAGI
NT seq 3198 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaaaagtatctgccattcctcagccgaaaacatatggaccgctgggtaatctc
ccattaatcgataaagataaaccgaccctatcctttatcaagatagcggaagagtatggt
cccatttttcaaattcaaactttaagtgataccattattgtcgtttccggacatgaactg
gtagcagaagtctgtgacgaaacacggttcgataaaagtatagagggtgctttagcaaaa
gttcgcgcctttgctggagacggattatttacaagcgagactcacgagcctaactggaaa
aaagctcataatattttgatgcctacatttagccaacgggcaatgaaagattaccatgct
atgatggttgatattgctgtacaactcgttcaaaaatgggcacggcttaatccgaatgaa
aacgtggatgttccggaggatatgactcgtcttacgttagatacaattggtctatgtggt
tttaattaccgatttaatagcttttatcgtgagacccctcatccttttattactagcatg
acccgtgctctagatgaggcgatgcaccaattacagcggttagatatagaagacaaactt
atgtggagaacgaaacgtcaatttcagcatgatatccagtctatgttttctttagtagat
aatattattgctgaacgtaaaagtagtggagatcaggaagaaaatgatttactttcccgt
atgttaaatgtacaagatccggaaactggtgaaaaattagatgatgaaaacattcgtttc
caaattatcacttttttaatagctgggcatgagacaacaagtggattgttatcttttgca
atttactttttattaaagaatccggataaattgaaaaaagcctatgaagaagtagaccgt
gttttgacagatcctactccaacataccaacaagttatgaaactgaagtatatacggatg
attttaaatgaatcactgcgtctatggcctaccgctccagcattcagtctctatgcaaaa
gaagatacagtgattggcgggaaatacccaattaagaaaggagaagatcgtatttctgtt
cttattccacagctacatagggataaagatgcatggggagacaatgtggaagaattccaa
cctgaacgatttgaagagctggataaggttcctcatcatgcttataagccatttggaaat
ggccagagagcatgtatcggtatgcaatttgcacttcatgaagccactcttgtaatggga
atgcttcttcaacattttgaattaatcgattatcaaaactatcagctggatgtaaaacaa
acattaacgctaaagcccggtgattttaagattaggattctaccccgaaaacaaactatt
agccatcctactgctcttgcacctacagaggacaagctgaaaaacgatgaaattaagcag
cacgttcagaagacaccttctattattggggccgataatctttcacttcttgttctgtat
ggctcggatacaggggtagcagaaggtattgcaagagaattagcagatacagctagttta
gaaggggttcgaacggaagtggtagctcttaacgatcgaattggaagtttgccaaaagaa
ggagcggtacttattgtgacttcttcttataatggaaaaccgccaagtaatgcagggcag
tttgtgcaatggttggaggaactaaaaacagatgagctaaaaggggttcaatacgcagtt
tttggttgtggagatcataattgggctagtacctatcaacggattccaagatacattgat
gagcagatggctcaaaaaggagcaacaagattttctaaacgcggagaagcagatgcaagt
ggtgattttgaggaacagctcgagcaatggaaacaaagcatgtggtctgatgcgatgaag
gcatttggattggagctcaacaaaaatatggaaaaagagcgcagtactttgagtctgcaa
tttgtcagtcgtcttggaggatctcctcttgcacgaacatatgaagcagtttatgcgtct
atactagaaaatcgtgaactccaatcatccagcagtgatagaagtacacgacatatcgag
gtatccttgccggaaggcgctacatataaagaaggagaccaccttggagtgctgccagtt
aatagcgagaaaaatatcaaccgaattttaagacgctttggattaaatgggaaggatcaa
gttatactgagtgcaagtggacgaagtataaatcacatacctttagacagtcctgttagt
ttattggaccttcttagttatagtgttgaagttcaagaagcagccactcgagcacaaata
cgagaaatggtaacattcacagcatgtcctcctcataaaaaagaattggaagcattatta
gaagaaggagtttaccatgaacaaatactaaagaaacggatttcaatgttggaccttctt
gaaaagtatgaggcttgtgaaatccgatttgaacgctttttagaacttcttcctgcgctc
aaaccgcgttactattctatttcaagctctccactcgttgtacagaatcgtctgagcatt
acggtcggtgttgttaatgcgcctgcatggagtggggaagggacatatgaaggagtcgct
tctaattacttagctcagcgtcataataaagatgagattatctgtttcattcgaacgcca
caatcaaactttgaattacctaaagatccagaaacaccaattattatggttgggccaggt
actggaattgcaccattccgtggattcttgcaagcgcgtcgtgttcaaaagcaaaaaggt
attaacttaggagaagcacatctatattttggttgtcgtcatcctgaaaaagattatctt
tatcgtacagaactagaaaatgatgaaagagatggattaatctctttacacacagctttt
tctcgtctagagggacatccaaaaacatatgtacagcatttaataaaacaagatagaatc
aatttaatttcgttattagataatggagctcatctttatatatgtggtgatggaagtaaa
atggctccggatgtagaagataccctttgtcaagcgtatcaagaaattcatgaagtcagt
gaacaagaagcaagaaattggttggatcgtgtgcaagatgaagggcgatatggaaaagat
gtttgggctggtatatga

DBGET integrated database retrieval system