KEGG   Bacillus thuringiensis serovar kurstaki HD73: HD73_2994Help
Entry
HD73_2994         CDS       T02460                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
btt  Bacillus thuringiensis serovar kurstaki HD73
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:btt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HD73_2994
  Amino acid metabolism
   00330 Arginine and proline metabolism
    HD73_2994
Enzymes [BR:btt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     HD73_2994
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2895130..2896191
Genome map
AA seq 353 aa AA seqDB search
MADSHGGISTEQLSDHVAALARLKEDGHEVVLITSGAVAAGFSALGYPSRPVTIKGKQAA
AAVGQSLLMQAYTEEFRKYGIVTAQLLLTRSDFSRKEQYSNAYATLGELLNRSALPIINE
NDSISLEELTFGDNDMLSALVSGLVSADMLMIFTDVNGLYDKNPQKNADAKKYYFLPEVT
EEISSLAGDAGSKLGTGGMKSKIDAAKTALSLGVSVFIGTGRGQEKFVDVLKGKGDGTYV
GNAPQKEMKMNKQWIALHSLVSGQIEVDAGAATAIIQHGKSLLPAGVTNVSGFFQVGEVV
EVVTQQGRVIGKGQCTYSAEELRDVKGMQSQDIQVRGERHSYEVIHRDHWVSL
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
ttggcagatagtcatggaggcatctctacagaacagctttcagatcacgttgccgcattg
gctcggttgaaagaagatgggcacgaggttgtgttaattacatctggagccgtcgctgca
ggtttttcagcgctaggatatcctagcagacctgtaacgattaaagggaaacaggctgca
gcagctgtcggacaaagtttgttaatgcaggcgtacacggaggaattccgtaaatatggc
atcgttactgcgcaacttttgctgacgagaagtgatttttctagaaaagaacaatatagt
aatgcttacgctacgttaggagaattattaaaccgttccgctcttccaattattaatgaa
aatgattccatctctttagaggagctaacgttcggtgataatgatatgctgtcagcttta
gtaagcgggcttgtttcggcggatatgcttatgatctttacggatgtgaacgggttatat
gacaaaaatcctcagaaaaatgcggatgcaaaaaaatattattttcttcctgaagttacg
gaagaaatttcttctcttgcaggagatgcaggctcaaaacttgggactggcggtatgaaa
tcaaaaatcgatgctgcaaagacagcactctctcttggtgtgagtgtatttatcggaaca
ggacgtggacaggaaaagtttgtagatgttttgaagggtaagggtgatggaacgtatgtt
ggtaatgctcctcaaaaagaaatgaagatgaacaagcaatggattgccttgcattcgctt
gttagcggacaaattgaagtagatgctggggcagctactgccatcattcagcatgggaag
agtttacttccagctggtgttacgaatgtatcaggatttttccaagtgggtgaagttgta
gaggttgtaacgcaacaagggcgcgtaataggaaaaggacaatgcacatatagtgcagag
gaactaagagatgtaaaaggtatgcaaagccaagatattcaagtaagaggcgagagacat
agttatgaagtcatccatagggatcattgggtttcactttaa

DBGET integrated database retrieval system