KEGG   Bacillus thuringiensis serovar kurstaki HD73: HD73_2994Help
Entry
HD73_2994         CDS       T02460                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
btt  Bacillus thuringiensis serovar kurstaki HD73
Pathway
btt00330  Arginine and proline metabolism
btt00332  Carbapenem biosynthesis
btt01100  Metabolic pathways
btt01130  Biosynthesis of antibiotics
btt01230  Biosynthesis of amino acids
Module
btt_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:btt00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    HD73_2994
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    HD73_2994
Enzymes [BR:btt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     HD73_2994
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AGE78572
Position
2895130..2896191
Genome map
AA seq 353 aa AA seqDB search
MADSHGGISTEQLSDHVAALARLKEDGHEVVLITSGAVAAGFSALGYPSRPVTIKGKQAA
AAVGQSLLMQAYTEEFRKYGIVTAQLLLTRSDFSRKEQYSNAYATLGELLNRSALPIINE
NDSISLEELTFGDNDMLSALVSGLVSADMLMIFTDVNGLYDKNPQKNADAKKYYFLPEVT
EEISSLAGDAGSKLGTGGMKSKIDAAKTALSLGVSVFIGTGRGQEKFVDVLKGKGDGTYV
GNAPQKEMKMNKQWIALHSLVSGQIEVDAGAATAIIQHGKSLLPAGVTNVSGFFQVGEVV
EVVTQQGRVIGKGQCTYSAEELRDVKGMQSQDIQVRGERHSYEVIHRDHWVSL
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
ttggcagatagtcatggaggcatctctacagaacagctttcagatcacgttgccgcattg
gctcggttgaaagaagatgggcacgaggttgtgttaattacatctggagccgtcgctgca
ggtttttcagcgctaggatatcctagcagacctgtaacgattaaagggaaacaggctgca
gcagctgtcggacaaagtttgttaatgcaggcgtacacggaggaattccgtaaatatggc
atcgttactgcgcaacttttgctgacgagaagtgatttttctagaaaagaacaatatagt
aatgcttacgctacgttaggagaattattaaaccgttccgctcttccaattattaatgaa
aatgattccatctctttagaggagctaacgttcggtgataatgatatgctgtcagcttta
gtaagcgggcttgtttcggcggatatgcttatgatctttacggatgtgaacgggttatat
gacaaaaatcctcagaaaaatgcggatgcaaaaaaatattattttcttcctgaagttacg
gaagaaatttcttctcttgcaggagatgcaggctcaaaacttgggactggcggtatgaaa
tcaaaaatcgatgctgcaaagacagcactctctcttggtgtgagtgtatttatcggaaca
ggacgtggacaggaaaagtttgtagatgttttgaagggtaagggtgatggaacgtatgtt
ggtaatgctcctcaaaaagaaatgaagatgaacaagcaatggattgccttgcattcgctt
gttagcggacaaattgaagtagatgctggggcagctactgccatcattcagcatgggaag
agtttacttccagctggtgttacgaatgtatcaggatttttccaagtgggtgaagttgta
gaggttgtaacgcaacaagggcgcgtaataggaaaaggacaatgcacatatagtgcagag
gaactaagagatgtaaaaggtatgcaaagccaagatattcaagtaagaggcgagagacat
agttatgaagtcatccatagggatcattgggtttcactttaa

DBGET integrated database retrieval system