KEGG   Bacillus thuringiensis serovar kurstaki HD73: HD73_2994Help
Entry
HD73_2994         CDS       T02460                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
btt  Bacillus thuringiensis serovar kurstaki HD73
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:btt01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:btt00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2895130..2896191
Genome map
AA seq 353 aa AA seqDB search
MADSHGGISTEQLSDHVAALARLKEDGHEVVLITSGAVAAGFSALGYPSRPVTIKGKQAA
AAVGQSLLMQAYTEEFRKYGIVTAQLLLTRSDFSRKEQYSNAYATLGELLNRSALPIINE
NDSISLEELTFGDNDMLSALVSGLVSADMLMIFTDVNGLYDKNPQKNADAKKYYFLPEVT
EEISSLAGDAGSKLGTGGMKSKIDAAKTALSLGVSVFIGTGRGQEKFVDVLKGKGDGTYV
GNAPQKEMKMNKQWIALHSLVSGQIEVDAGAATAIIQHGKSLLPAGVTNVSGFFQVGEVV
EVVTQQGRVIGKGQCTYSAEELRDVKGMQSQDIQVRGERHSYEVIHRDHWVSL
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
ttggcagatagtcatggaggcatctctacagaacagctttcagatcacgttgccgcattg
gctcggttgaaagaagatgggcacgaggttgtgttaattacatctggagccgtcgctgca
ggtttttcagcgctaggatatcctagcagacctgtaacgattaaagggaaacaggctgca
gcagctgtcggacaaagtttgttaatgcaggcgtacacggaggaattccgtaaatatggc
atcgttactgcgcaacttttgctgacgagaagtgatttttctagaaaagaacaatatagt
aatgcttacgctacgttaggagaattattaaaccgttccgctcttccaattattaatgaa
aatgattccatctctttagaggagctaacgttcggtgataatgatatgctgtcagcttta
gtaagcgggcttgtttcggcggatatgcttatgatctttacggatgtgaacgggttatat
gacaaaaatcctcagaaaaatgcggatgcaaaaaaatattattttcttcctgaagttacg
gaagaaatttcttctcttgcaggagatgcaggctcaaaacttgggactggcggtatgaaa
tcaaaaatcgatgctgcaaagacagcactctctcttggtgtgagtgtatttatcggaaca
ggacgtggacaggaaaagtttgtagatgttttgaagggtaagggtgatggaacgtatgtt
ggtaatgctcctcaaaaagaaatgaagatgaacaagcaatggattgccttgcattcgctt
gttagcggacaaattgaagtagatgctggggcagctactgccatcattcagcatgggaag
agtttacttccagctggtgttacgaatgtatcaggatttttccaagtgggtgaagttgta
gaggttgtaacgcaacaagggcgcgtaataggaaaaggacaatgcacatatagtgcagag
gaactaagagatgtaaaaggtatgcaaagccaagatattcaagtaagaggcgagagacat
agttatgaagtcatccatagggatcattgggtttcactttaa

DBGET integrated database retrieval system