KEGG   Bacillus thuringiensis serovar kurstaki HD73: HD73_4770Help
Entry
HD73_4770         CDS       T02460                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
btt  Bacillus thuringiensis serovar kurstaki HD73
Pathway
btt00860  Porphyrin and chlorophyll metabolism
btt01100  Metabolic pathways
btt01110  Biosynthesis of secondary metabolites
btt01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:btt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HD73_4770
Enzymes [BR:btt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     HD73_4770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: AGE80348
Position
complement(4578749..4579501)
Genome map
AA seq 250 aa AA seqDB search
MNALAGKTVLITRAQHQAKQMSVAVKEKSGIPLEIPLLRMEGMSHRQIQHIEEQLHSYDW
VIFTSRNGVAFFIDSLKKKLPLTIKIAAVGVKTKLELEKRGYQVHFVPTSFVAEAFAEEF
LKELSGNERILFPKGNLAREVIPVALREIGISLDELTVYGTKVNIEKKQELIAALKLGKV
DIITFTSPSTVTSFVRLLKGTNWREWTKKCTIACIGPITEKEASLYFPSVIVPKEYTVEA
LLQCVCESIK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctctcgctggaaaaacggtattgattacacgtgcccagcatcaagcgaaacaa
atgagtgtagcagtgaaagaaaagagcggaattccattggaaattccgcttttgcgtatg
gaaggtatgtctcataggcaaattcaacatattgaagagcagctacattcatacgactgg
gttatttttacgagcagaaatggtgtagctttttttatagatagtttaaaaaagaaacta
ccactaaccattaaaatcgctgcggtaggtgtgaaaacaaaattagagttagaaaaaagg
ggctatcaagttcattttgttcccacttcatttgttgcagaagcatttgcagaagagttt
ctaaaagaattaagtggaaatgaacgtattttatttccgaaagggaatttagcaagagag
gtaattccggttgccctacgggaaattggtatttctctagatgagctaaccgtatacggt
acgaaagtgaatatagaaaaaaagcaagagcttatagcggcattgaagttagggaaagta
gacattattacatttacgagcccttcaactgttactagttttgttcgtttacttaagggt
acaaactggagagaatggacaaaaaaatgtacaattgcttgtataggacctattacggaa
aaagaggcaagtctttattttccgtctgttattgtgccgaaagagtacactgtagaagca
ttactacaatgtgtttgtgaatctataaaatga

DBGET integrated database retrieval system