KEGG   Bacillus thuringiensis serovar kurstaki HD73: HD73_5737Help
Entry
HD73_5737         CDS       T02460                                 

Definition
Thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
btt  Bacillus thuringiensis serovar kurstaki HD73
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:btt00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5465213..5465800)
Genome map
AA seq 195 aa AA seqDB search
MYLINQNGWIEVICGSMFSGKSEELIRRVRRTQFAKQHAIVFKPCIDNRYSEEDVVSHNG
LKVKAVPVSASKDIFEHITEELDVIAIDEVQFFDGDIVEVVQVLANRGYRVIVAGLDQDF
RGLPFGQVPQLMAIAEHVTKLQAVCSVCGSPASRTQRLIDGEPAAFDDPIILVGASETYE
PRCRHCHAVPANKDK
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgtacttaataaatcaaaatggctggattgaagtgatttgcggtagtatgttttctggc
aagtcagaagagctaatccgccgtgtgcgccgtacgcaatttgcaaaacaacatgcaatt
gtatttaaaccatgtattgataatcgatatagtgaagaagatgtagtatcacataacgga
ttaaaggtaaaagcagttcctgtttcagcttcaaaggatatatttgaacatattacagaa
gagctggatgttattgcaatcgatgaggtgcaattttttgatggggacattgtggaagtg
gtgcaagtattggcaaatcgtggctatcgtgtcattgtagctggtttagaccaagatttc
cgtggtctaccatttggacaagttcctcagctgatggcgattgctgaacatgtgacaaaa
ctacaagcagtatgttctgtatgtggatctccagcaagtcgtacacaacgattaattgat
ggagaaccagcggcatttgatgatccaattattttagttggagcttcagaaacgtatgaa
ccgcgttgtcgtcattgtcatgcagtacctgcaaacaaagataagtaa

DBGET integrated database retrieval system