KEGG   Borrelia turicatae: BT0023Help
Entry
BT0023            CDS       T00737                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
btu  Borrelia turicatae
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:btu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BT0023 (ruvA)
Enzymes [BR:btu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BT0023 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(22158..22748)
Genome map
AA seq 196 aa AA seqDB search
MINKICGKIVEKRESSIVIVALPFEFEILVSSFCNAELGLQEDVEILTYLHLREDEIRLF
GFLNVSEREVFEKLISVDGIGPKAALRILSGIKYNEFRDAVEREDVKLISNVKGIGNKMA
GKIFLKLRGKLVKVNEASSGVLKFKELEQSIVNMGFDRKLVAAAIKEIMLIDEFLMLRQV
DQEQFLFREILRKLSG
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgatcaataagatttgtggtaaaattgtagagaaaagagagtctagtattgtcattgta
gcacttccctttgaatttgagattttagttagttctttttgtaatgcagaattagggttg
caagaagatgttgaaatattaacttatcttcatcttcgagaggatgaaattagacttttt
ggttttttaaatgtatcggaaagagaagtttttgaaaaacttattagtgttgatggaata
ggtccaaaagcggctttgaggatattatctgggataaaatataatgaatttagagatgca
gttgaaagagaagatgttaagcttatttctaatgtcaagggcattggaaataaaatggca
ggcaaaatctttttaaaacttagggggaaacttgttaaagttaatgaggcaagttcaggt
gtattgaaatttaaggagcttgaacaatcaattgttaatatgggttttgatagaaaattg
gttgcagctgctattaaggaaattatgcttattgatgagtttttaatgttgagacaagtt
gatcaagaacaatttttgtttagagaaattttaagaaagctttcaggttaa

DBGET integrated database retrieval system