KEGG   Borrelia turicatae: BT0166Help
Entry
BT0166            CDS       T00737                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
btu  Borrelia turicatae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:btu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BT0166
Enzymes [BR:btu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     BT0166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(166360..167841)
Genome map
AA seq 493 aa AA seqDB search
MKRKSGILLNISSLPSKYGIGDLGRGAYKFIDFLADSSQGYWQILPYSPPSFLEFPYSSY
SAFAGNINYIDLNAIDRFIDIDLGTFECLEDRYVDYDKLKAKEVILRNAALNFLHRATID
EIHAFEKFKKSAAYWLLDFSSFVAFKEYYSKFQSSQAFNLLFSREILKRDAKALAKLRET
LEVEINIQQVLQYFFFSQFKALKKYANNAGIKIVSDIPIFVSYDSADVWAHQKYFKLRFD
ASKDKVTGVPPDCLFSKKYLWGNAAYNWKALRKDDYVWWINRIDFLRKYVDIVRIDYFRG
FVSTWEVSAEESLLFGGQWVKCPGKDFFKQILNEINDLEIWVEDLVKDRGDTFRLRDYFG
FPGTKMMQCAFDFDSANIYLPHNYIRNCVVYTGTHESNTIRGFINSVDNEHKKYIFDYFN
TSENAIVWDMIRGAMASVANSVIIPMKDYLDLVADFSMNISDAMLNNFRILSGDLSDDLS
KKISDITKLYGRT
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaaaaagtggaattttgctaaatattagttctctgccatctaaatacggtatt
ggtgatttaggaagaggggcatataaatttatagattttcttgccgattcatcacaaggt
tattggcagatattgccttattcgcctcctagttttttggagtttccttattcaagttat
tctgcatttgctggtaatatcaattatattgatttgaatgctattgataggtttattgat
atagacttaggcacttttgaatgcttggaagatagatatgttgattatgataagttaaaa
gctaaggaagttattttaagaaatgctgctttgaattttttgcacagggcaacaattgat
gagattcatgcatttgaaaagtttaaaaaatcagctgcttattggcttttagatttttca
agttttgttgcttttaaagagtactattctaaatttcaatcttcacaggcttttaatctt
ttatttagtagagaaattttaaaaagggatgctaaggctttagctaagcttagagagaca
cttgaggttgagatcaatattcaacaagttttacaatatttctttttttcacaatttaaa
gctttaaaaaaatatgctaataatgctggaattaaaatagtaagtgatattcctattttt
gtgtcttatgattctgctgatgtttgggcgcatcaaaaatattttaaattaaggtttgat
gcaagtaaagataaggtaacgggtgtacctcctgattgcttgtttagcaaaaaatatctt
tggggtaatgcagcttataattggaaagctttaagaaaagatgattatgtatggtggatt
aatcgtattgattttttgcgtaaatatgtggatattgttagaatcgactattttagagga
tttgtatcaacttgggaggtttctgcagaagaatctttgttatttggtggacaatgggta
aaatgtcctgggaaagatttttttaaacagattctaaatgagattaatgacttagaaatt
tgggttgaagaccttgtaaaagatcgtggagatacatttaggttaagagattattttggt
tttcctggaactaaaatgatgcaatgtgcatttgattttgattccgcaaatatatatctt
ccccataattatataagaaattgtgttgtttatacaggtactcatgagagtaatactatt
cgtggatttattaactctgttgataatgagcataaaaaatatatttttgattatttcaat
actagtgaaaatgctattgtttgggatatgataaggggggcgatggctagtgttgcaaat
agtgtaataattccaatgaaagattatcttgatttggtagctgattttagtatgaatata
tctgatgcaatgcttaacaattttagaatattaagtggtgatttgagtgacgatttaagc
aaaaagataagtgacattacaaaactttatggaagaacttaa

DBGET integrated database retrieval system