KEGG   Borrelia turicatae: BT0201Help
Entry
BT0201            CDS       T00737                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--L-ornithine ligase (EC:6.3.2.-)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
btu  Borrelia turicatae
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:btu00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:btu00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(199507..201027)
Genome map
AA seq 506 aa AA seqDB search
MNMNKKMLNNVLSKLDKNFVKEIKGSCEVEILGLTYDSRCVLSHFVFFALPGLHFDGQEF
INSAIEQGSNVIVHTNDINFYDPNVTYIKIDSCNIKKFMSNFAHIFYNEPSKNLKIIGVT
GTDGKSSVCFYIYTLLKSMGVKVGFISTVFFEDGSGTLVKNPYRQSTPESTEIHLVLSKM
VENNVEYAIVESTSHGLDIRTSRLIDIAYFVAVLTNVSHEHLEFHGTMQHYLNAKLNLFS
SADANGGFGIINMDDKNFSTFLNTINRAYTYSLENKNADFFVSKINEQMGFTEFEFYHKN
VKYDARVNLTGSFNVENVMAALIVVSQVMNVDVSELIDKLVNIEGLFGRMQGVDFGQDFS
LIIDYAHTPGAFLKIFPIFKRLSKNRLISVFGSAGERDVLKRKLQGEIADRYSDIIILCD
EDPRGEDSMQIIRDIAEGISGKTLNRDLFFIPDRKSAIEKAINIAHTDDLVVTLGKGHEN
SIIYKDRSIFWDEQAVVKDIISRNRS
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgaataaaaaaatgcttaataatgttttatctaagttagataagaattttgta
aaggaaattaaagggtcttgtgaagtagaaatcttgggacttacatatgattcaagatgt
gttttatctcattttgtattttttgctcttccaggacttcattttgatggtcaagaattt
atcaattcggcaattgagcagggtagtaatgttattgttcatactaatgatattaatttt
tatgatcccaatgtgacatatattaaaattgattcttgtaatataaaaaaatttatgtca
aattttgctcatattttttataatgagccttcaaaaaatcttaagattattggcgttaca
ggaactgatggtaaaagttctgtttgtttttatatctatactctattaaaatctatgggt
gttaaagttggttttatttcaacggtattctttgaagatggaagtggaacgctagttaag
aatccttataggcagtcgactccagagtcaacagaaattcatttagttcttagtaaaatg
gtagaaaacaatgttgaatatgctattgttgaatcgacttcgcatggccttgatattaga
acatcaagactcattgatattgcgtactttgttgctgttttaactaatgttagtcatgaa
catcttgaatttcatggtactatgcagcattatttaaatgctaagcttaatcttttctct
tctgcagatgctaatggtggttttggtattattaatatggatgataaaaatttttctacc
tttttaaatactattaatagggcttatacgtatagtttagagaataaaaatgctgatttt
tttgtaagtaagattaatgaacaaatgggttttactgaatttgagttttatcataagaat
gttaaatatgatgctagagttaatttgactggcagtttcaatgtcgaaaatgttatggcg
gctttgattgttgttagtcaagttatgaacgttgatgtttcagaacttattgataagctt
gtaaatattgagggtctttttggacgaatgcaaggtgttgattttgggcaggatttttct
ttaattattgattatgcgcatacacccggagcttttcttaaaatttttcctatctttaaa
agactttcaaaaaatagattgatttctgtttttggttctgctggagagagagatgttctt
aagagaaagttgcaaggagaaattgcagatagatattcagatataataatactttgcgat
gaagatccaagaggtgaagatagtatgcaaataattagagatattgcggaaggaatttca
ggaaaaactttaaatagagatttatttttcattcctgatcgaaaaagtgcaattgaaaag
gcaataaatattgcacatactgacgatttggtggttactcttggaaaggggcatgaaaac
tcaataatatataaagatcgaagtatattttgggatgagcaagctgttgttaaagatata
atttcgagaaataggagttga

DBGET integrated database retrieval system