KEGG   Borrelia turicatae: BT0207Help
Entry
BT0207            CDS       T00737                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
btu  Borrelia turicatae
Pathway
btu00052  Galactose metabolism
btu00500  Starch and sucrose metabolism
btu00520  Amino sugar and nucleotide sugar metabolism
btu01100  Metabolic pathways
btu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:btu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BT0207
   00052 Galactose metabolism
    BT0207
   00500 Starch and sucrose metabolism
    BT0207
   00520 Amino sugar and nucleotide sugar metabolism
    BT0207
Enzymes [BR:btu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BT0207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AAX17543
UniProt: A1QZ01
Position
207298..208128
Genome map
AA seq 276 aa AA seqDB search
MKGIILAAGYGTRFLPITKTIPKEMLPILNKPSIDYIIEEFTSSGIKEILIITSRRKGVL
DNYFDREIELETVFTKECKKDLLEKIKLKDINISFIRQNEMMGTGHALLHAKPWIGTDNV
IVAYPDDLHVGSPSLTTQLIELHKKTGKNILSVIENPKDINRYGVIKLNKDNIHVKDIVE
KPEVGKEPSNKASIGRFLYTHEFFKFLEEGFKIHQKGEYHHIYALKKLMSENKVLYKEIE
GERLDIGDIGGYLEAIIKIAKRDDKLLQIIKDSLRN
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggtattatcttagctgcgggatacggaacaaggttcttacccataacaaaaact
attccaaaggaaatgctaccaattttaaacaaaccatcaattgattacattattgaagaa
tttactagttctggaatcaaagaaatactaataataacttcaagaagaaagggtgttttg
gataattattttgatagagaaattgaactcgaaactgtatttaccaaagaatgtaaaaaa
gacttgctagaaaaaatcaaacttaaagatattaatattagctttataaggcaaaatgaa
atgatgggcacaggtcacgctctactgcatgcaaaaccctggataggtactgacaatgta
atagtcgcataccctgacgatttacatgttggatcaccatccttaacaacacaattaata
gaattgcataaaaaaactggaaaaaacatattatctgttattgaaaatcctaaagacatt
aacagatatggagtaataaaattaaataaagacaatattcatgtcaaagacatagtagaa
aagccagaagttggcaaagaaccaagcaataaagcatctattggaagattcttatatacc
catgaatttttcaaatttttagaagaaggatttaaaattcaccaaaaaggagaatatcat
catatttatgccttaaaaaaactcatgtctgagaacaaagtattatacaaagaaatagaa
ggcgaaagacttgacataggtgatattgggggatatttagaagcaataatcaaaattgca
aaacgtgatgataaattattacaaatcattaaagattcactaaggaactaa

DBGET integrated database retrieval system