KEGG   Borrelia turicatae: BT0207Help
Entry
BT0207            CDS       T00737                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
btu  Borrelia turicatae
Pathway
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:btu00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:btu00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:btu00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
207298..208128
Genome map
AA seq 276 aa AA seqDB search
MKGIILAAGYGTRFLPITKTIPKEMLPILNKPSIDYIIEEFTSSGIKEILIITSRRKGVL
DNYFDREIELETVFTKECKKDLLEKIKLKDINISFIRQNEMMGTGHALLHAKPWIGTDNV
IVAYPDDLHVGSPSLTTQLIELHKKTGKNILSVIENPKDINRYGVIKLNKDNIHVKDIVE
KPEVGKEPSNKASIGRFLYTHEFFKFLEEGFKIHQKGEYHHIYALKKLMSENKVLYKEIE
GERLDIGDIGGYLEAIIKIAKRDDKLLQIIKDSLRN
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggtattatcttagctgcgggatacggaacaaggttcttacccataacaaaaact
attccaaaggaaatgctaccaattttaaacaaaccatcaattgattacattattgaagaa
tttactagttctggaatcaaagaaatactaataataacttcaagaagaaagggtgttttg
gataattattttgatagagaaattgaactcgaaactgtatttaccaaagaatgtaaaaaa
gacttgctagaaaaaatcaaacttaaagatattaatattagctttataaggcaaaatgaa
atgatgggcacaggtcacgctctactgcatgcaaaaccctggataggtactgacaatgta
atagtcgcataccctgacgatttacatgttggatcaccatccttaacaacacaattaata
gaattgcataaaaaaactggaaaaaacatattatctgttattgaaaatcctaaagacatt
aacagatatggagtaataaaattaaataaagacaatattcatgtcaaagacatagtagaa
aagccagaagttggcaaagaaccaagcaataaagcatctattggaagattcttatatacc
catgaatttttcaaatttttagaagaaggatttaaaattcaccaaaaaggagaatatcat
catatttatgccttaaaaaaactcatgtctgagaacaaagtattatacaaagaaatagaa
ggcgaaagacttgacataggtgatattgggggatatttagaagcaataatcaaaattgca
aaacgtgatgataaattattacaaatcattaaagattcactaaggaactaa

DBGET integrated database retrieval system