KEGG   Borrelia turicatae: BT0241Help
Entry
BT0241            CDS       T00737                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
btu  Borrelia turicatae
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:btu00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
245612..247111
Genome map
AA seq 499 aa AA seqDB search
MNMKYILSIDQGTTSSRAIIFDKKANIKGFAQKEFKQIYPYPSWVEHNPNEIWSSILGVM
AEALANARTFPNEIEAIGITNQRETTIIWDRQTGHPIYNAIVWQDRRTAQLCDELKARGQ
DKNFLKKTGLVLDAYFSGTKIKWILDNVAGARKRAEKGELCFGTIDTWIVWNLTKGKIHI
TDYSNASRTLLLNIKSLEWDEELLQILNIPKSILPELKQSSEVYGKTDSSILGTEITISG
IAGDQFAATFGQACLQKGMAKNTYGTGCFVTVNIGKNPIINEQQTLLTSIAWGRKNSITY
VLEGSVFIGGAVIQWLKDNLELFRKNSDAEALAASVNNNGGVYFVPAFVGLGTPHWDSYA
RGTIIGLTRSSTKEHITRAALESIALQSFDVLTEMQNSIQGFAIKELRVDGKASQNNLLM
QFQADILQCNVVRPKITETTALGSAYLAGLAVGYWESTEEITSLWKSDKIFEPSMENSKR
EDLIYNWHKAIKRAKDWIQ
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgaaatatattctatctattgatcaaggtacaactagttcaagagcaataata
tttgacaaaaaagcaaacataaaaggatttgcacaaaaagaatttaaacaaatttatcca
tatccaagttgggttgaacataatccaaacgaaatatggagctcaatattaggagtcatg
gcagaagctttagcaaatgcaagaacttttcccaatgaaattgaagcaattggaattacg
aatcaaagagaaacgacaattatttgggataggcaaacaggacatccaatttataacgca
atagtctggcaagatagaagaacagcacaactttgcgatgaattaaaagcaagaggacaa
gataaaaattttttaaaaaaaacaggtcttgtattagatgcttattttagcggtacaaaa
ataaaatggatattggataatgttgcaggagcaagaaaacgagcagaaaagggagaatta
tgttttggaacaatagatacttggatagtctggaaccttactaaaggaaaaatacatatt
acagattattctaatgcatcaagaaccctactcttaaacattaaatcacttgaatgggac
gaagaactactgcaaatattaaacatcccaaaatcaattctacctgaacttaaacaaagt
tccgaagtgtatggaaaaaccgactcttccatactggggacagaaatcactatttcagga
attgcgggtgatcagtttgcagcaacatttggacaagcatgtcttcaaaaaggaatggct
aaaaatacctatggaactggttgctttgttaccgttaatataggaaaaaaccctattatt
aatgaacaacaaacacttttaacgtcaattgcatggggaagaaaaaattcaataacttat
gttcttgagggaagtgttttcattggaggagctgtaattcaatggttaaaagataatcta
gaattatttagaaaaaatagtgatgcagaggcactggcagcctcagtaaataataatggg
ggtgtttattttgtaccagcatttgtaggccttggaacacctcattgggattcttatgcc
agaggaacaattattggacttacaagaagctcaacaaaagaacacattacaagagccgct
cttgagagcattgcattgcaaagctttgatgtactaaccgaaatgcaaaactcaattcaa
ggttttgcaataaaagaactaagagttgatggaaaagccagtcaaaataatctacttatg
caatttcaagctgatattttacagtgcaatgttgtcagaccaaaaattacagaaactact
gctcttggttctgcttatctggcaggacttgctgtgggatattgggaaagtactgaagag
attacaagtctttggaaatcagataaaatatttgaaccttcaatggaaaatagcaaaaga
gaagatttaatctataattggcataaagctattaagagagcaaaggattggatccaataa

DBGET integrated database retrieval system