KEGG   Borrelia turicatae: BT0415Help
Entry
BT0415            CDS       T00737                                 

Definition
protein-glutamate methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
btu  Borrelia turicatae
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:btu00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BT0415
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    BT0415
Enzymes [BR:btu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     BT0415
Two-component system [BR:btu02022]
 CheA family
  CheA-CheYBV
   BT0415
Bacterial motility proteins [BR:btu02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    BT0415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
426039..427175
Genome map
AA seq 378 aa AA seqDB search
MQIKIYVLVIEASSVNRKTISDIINSSLKLEVIATAANTDFALKKLKKHPDVILLSLEEE
TIKEITLIKKKENINNKLPVIILSSNKDIAKNAILKGADDFIIKTDNKLESIKDKIIDLL
SIYGNKTIKNKIITDINFKFKTNQYLINNKVNKENSNTTKATDKNENTNLNQEKIIDEKD
LKKLKNRKFEIVVIGISTGGPAALKTILPEIPKNFPLPIIIVQHMPKGFTTEFAKSLNNI
CNLTVKETSNKEILQKGFIYISSGGYHTRINKINENYQIEVFDAENVNGHKPSIGVLFKS
ISENVKDKAIALIMTGMGSDGSREIGEIKKAGGLTIAQDEKSSVVFGMPKIAIEENNIDY
IVSISHVVKLLKAILLDG
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgcaaataaaaatttatgtactcgtcattgaagcttcttctgttaatagaaagactata
tcagacattataaattcatctttaaagcttgaagttattgcaactgcagccaacacagac
ttcgcccttaaaaaacttaaaaaacacccagatgtaatactactcagtttagaagaagaa
acaatcaaagaaattactctcataaaaaaaaaggaaaatataaacaacaagctccctgtt
attatcctctcatcaaacaaagacatagcaaaaaatgctatcttaaaaggtgctgatgac
tttataataaaaactgataacaaattagaaagcataaaagataaaattattgatttactc
tcaatttacggcaataaaaccataaaaaacaaaatcataactgacatcaatttcaaattc
aaaacaaatcaatatttgataaataacaaagtcaacaaagaaaattcaaatacaacaaaa
gcaacagataaaaatgaaaatacaaaccttaatcaagaaaaaataatagatgaaaaagat
ttaaaaaaacttaaaaacagaaaatttgaaatagttgttattggaatatctacaggaggc
cctgcggcactaaagacaatactaccagaaattcctaaaaattttcctttaccaataata
attgttcaacatatgccaaaaggatttacaacagaattcgcaaaaagccttaacaatatt
tgcaacttaactgtcaaagaaacaagtaataaagaaatacttcaaaaaggattcatatac
ataagttctgggggataccatacaagaattaataaaataaacgaaaactatcaaatagaa
gtcttcgatgctgagaatgtaaatggacacaaaccttctataggagtactctttaagtca
atatcagaaaatgtgaaagacaaagcaatagctttaataatgactggaatgggaagtgat
ggctctagagaaattggagagattaaaaaagctggtggattaactattgcacaagatgag
aaaagttcagtggtttttggaatgcccaaaatagcaatagaagaaaataatatagactat
atagtttcaataagtcatgtggtaaaattattaaaagccattcttcttgatggttaa

DBGET integrated database retrieval system