KEGG   Borrelia turicatae: BT0462AHelp
Entry
BT0462A           CDS       T00737                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
btu  Borrelia turicatae
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:btu03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
486334..486918
Genome map
AA seq 194 aa AA seqDB search
MIIQDLIVLLSKLPGIGRKTAVRMVYDILYNGEEYSRALGQILIGFHSSIRKCKNCHNLA
EGEFCNICMDLSRCKDMICIVEMPQDLEVIESTREYDGLYFVLHGHLDPLRDIGPNRLNL
DKLENYVREVGAQEVIIATEFSIEGDVTANYISGILKNLGINVTRIASGLPAGGSISNAD
KITTLRALRLRLKM
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
ttgattatacaagatttaattgttttactttctaagttgccaggtataggtagaaagaca
gcagtacgaatggtttatgatattttgtataatggtgaagagtattcaagagctctggga
caaattttaatcgggtttcattctagtataagaaaatgtaaaaattgtcataatcttgct
gagggagaattttgtaatatttgtatggatttaagtagatgtaaagatatgatttgtatt
gtggagatgccgcaagacttagaggttattgagtctactagagaatatgatggattgtat
tttgtgcttcatggtcatcttgatcctttaagagatattggtccaaataggctaaatctt
gataaattagaaaattatgttagggaagttggggctcaagaagtgattattgctacagaa
ttcagtattgaaggggatgtaactgcaaattatattagtggcattttaaaaaatttaggt
attaatgttacaagaatagcatctggtctgcccgctggaggtagtattagtaatgcagat
aaaattactactctgagggctttgcgtttaagacttaagatgtaa

DBGET integrated database retrieval system