KEGG   Borrelia turicatae: BT0462AHelp
Entry
BT0462A           CDS       T00737                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
btu  Borrelia turicatae
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:btu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BT0462A
DNA repair and recombination proteins [BR:btu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BT0462A
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
486334..486918
Genome map
AA seq 194 aa AA seqDB search
MIIQDLIVLLSKLPGIGRKTAVRMVYDILYNGEEYSRALGQILIGFHSSIRKCKNCHNLA
EGEFCNICMDLSRCKDMICIVEMPQDLEVIESTREYDGLYFVLHGHLDPLRDIGPNRLNL
DKLENYVREVGAQEVIIATEFSIEGDVTANYISGILKNLGINVTRIASGLPAGGSISNAD
KITTLRALRLRLKM
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
ttgattatacaagatttaattgttttactttctaagttgccaggtataggtagaaagaca
gcagtacgaatggtttatgatattttgtataatggtgaagagtattcaagagctctggga
caaattttaatcgggtttcattctagtataagaaaatgtaaaaattgtcataatcttgct
gagggagaattttgtaatatttgtatggatttaagtagatgtaaagatatgatttgtatt
gtggagatgccgcaagacttagaggttattgagtctactagagaatatgatggattgtat
tttgtgcttcatggtcatcttgatcctttaagagatattggtccaaataggctaaatctt
gataaattagaaaattatgttagggaagttggggctcaagaagtgattattgctacagaa
ttcagtattgaaggggatgtaactgcaaattatattagtggcattttaaaaaatttaggt
attaatgttacaagaatagcatctggtctgcccgctggaggtagtattagtaatgcagat
aaaattactactctgagggctttgcgtttaagacttaagatgtaa

DBGET integrated database retrieval system