KEGG   Borrelia turicatae: BT0568Help
Entry
BT0568            CDS       T00737                                 

Definition
protein-glutamate methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
btu  Borrelia turicatae
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:btu02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:btu02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
586738..587889
Genome map
AA seq 383 aa AA seqDB search
MKILIIDIQGLIRQVFVRAFSKDLNVEILNPGSNSLNLINVFLQKFPDLVIVDENSAKSH
FGNALNNVLNNISLPVIFIAEDEVYPQFGFLESKRDKIKLIINKLNFKLTVNLFRSDYLD
LIKSEIKKLAGNKFIVSFETKRIKAPDSFVKSESKKSEGSISGITRSYKVADVINVAPKN
DPDVILKYQGVINKNKTGKVIFVGSSTGGTEALRVFLKFFKRDSPPIVIVQHMPGGFTTS
FAKSLNNELEIDVKEAEDGDILRPGLVIIANGHYHLIVKYANGNYFVNLLDGPLVSRHKP
SVNVLFRSAAMYAGENAIGVMLTGMGDDGACCMLEMKKSGAYNIAQDQVTSVVFGMPMEA
IKIGAVDKVLPLNKISEYILRRS
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatattgatcattgatattcaaggtcttataagacaggtttttgttagagctttt
tctaaggatttaaatgttgagatattaaatccaggttctaattctttaaaccttattaat
gtttttttacaaaaatttcctgatttggttattgttgatgaaaattctgccaagtctcat
tttggaaatgctcttaataatgttcttaataatatctcacttcctgttatttttatagca
gaagatgaagtttatccacaatttggttttcttgaatctaagagagataaaattaaacta
ataataaataaacttaactttaaacttacagttaatttatttagaagtgattatttggat
ttaataaaatctgagatcaagaaactagctggtaataaatttattgtttcttttgagact
aagagaataaaagcccctgattcttttgttaagtctgagagtaaaaaatctgaaggtagt
atttctggtataacaagaagctataaggttgccgatgtgattaatgttgctcctaagaat
gatccagatgttattctgaaatatcaaggtgttattaataaaaataaaaccggaaaagtt
atttttgttggttcttcaactggtggtactgaggctttaagagtatttttaaagtttttt
aaaagagactctcctccaattgttattgttcagcatatgccagggggttttacaacatct
tttgcaaagagtttgaataatgagcttgaaattgatgtaaaagaggctgaagatggagat
attttaaggcctggtcttgtaataattgccaatggtcattatcatttaattgtgaagtat
gctaatgggaactattttgttaatttattagatggtcctttagttagtagacataagcct
tctgttaatgtcttgtttcgttctgcggctatgtatgctggagaaaatgctattggggtt
atgcttacgggaatgggagatgatggtgcttgttgtatgcttgagatgaagaaaagtggt
gcatataacatcgcgcaagatcaggtaacgtctgtggtatttggaatgcctatggaggca
ataaaaataggtgctgtagataaggttcttcctttaaataaaatatctgaatatatttta
aggagatcttaa

DBGET integrated database retrieval system