KEGG   Borrelia turicatae: BT0620Help
Entry
BT0620            CDS       T00737                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
btu  Borrelia turicatae
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:btu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BT0620
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    BT0620
Enzymes [BR:btu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BT0620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(650779..652434)
Genome map
AA seq 551 aa AA seqDB search
MKKIVCIAIFFIHNNCFAYNFWTTEDKEKLIDNIVSQMDDKELLGQMFMISYPKEQITKF
VLNFIKEKNLGGIKIFGWNAKNLHTLIESINKAQSMSQNNRFKIPLFIATDQEGGWTQHI
KLKTSKTIGNLGITATLSPNDSYLTGYHIANELRQLGINLNFAPITDIYSNEENFTIGPR
TYSNNPQIVSLFALAFYKGQKQAGIISTAKHFPGHGNTIVDSHIKMPIINSNLKEMQSNE
LLPYKILIQENIPMIMSGHLAYPMLTNGKEIPASSSIKIIKELLRKKLKYDNLIITDDLL
MNAVRYNNESIYDTIERIIRTETDILLISLNENIQNNAYNKLLSLMQKDSEIRENIIKSN
KRILRIKLEYLKERKNETEIYSNHKKVQAIPTKEAKNFFEQSTLRGITKIKLSKQVSKHK
KTLLISPYNTMIKEGKKIFQNSSGYYYDYYPLNNMNPTKLKEIKKLIEKHEQVIFNLSTP
ASQQYIENLKEYKDKISIIVSLTPQYIKNLDWIQNIVIVYGTTILSFKSGFLTLTEDFNP
KGKSPLINFKP
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattgtttgtatagctatcttttttatccataataattgtttcgcctacaac
ttttggactacagaagataaagaaaaattaatagataacatagtaagtcaaatggatgat
aaagaattattgggccaaatgttcatgataagttacccgaaagaacaaataacaaaattt
gtactaaacttcataaaagagaaaaacttagggggaattaaaatctttggatggaatgcc
aaaaacttacacacgctaatagaaagtataaataaagcacaatcgatgtcccaaaacaat
agatttaaaatacctttatttatagcaacggatcaagaaggtggatggacacaacatata
aaactcaaaacatcaaaaacaataggaaatcttggaatcacagctactctatcaccaaat
gattcctaccttacaggatatcacatagcaaatgagctaagacaacttggaatcaatcta
aattttgcacctataacagacatttacagcaatgaggaaaattttacaataggaccaagg
acatattcaaataatccacaaatcgtttctctttttgctctagctttttataaaggacaa
aaacaagcaggaataatttcaacagcaaaacacttccccggacatgggaatactattgtt
gattctcacataaaaatgccaataataaactcaaatttaaaagaaatgcaatcaaatgaa
ttattgccatataaaatattaatacaagaaaatattccaatgattatgagcggacatcta
gcatacccaatgcttacaaatggcaaagaaatacccgcatcatcttcaattaaaatcata
aaggaactacttagaaaaaagttgaaatatgataatttaataataacagatgatttatta
atgaatgcagtaagatataacaatgaaagcatttatgacacaattgaaagaattattaga
actgaaactgatattttattaatatcactaaacgaaaatatacaaaacaatgcatacaat
aaactattaagcctcatgcaaaaagatagtgaaataagagaaaatatcattaaatctaac
aagagaatacttagaataaagttagaatacttaaaagaaagaaaaaatgaaactgaaatt
tattcaaatcataaaaaagttcaagcaatacctactaaagaagctaaaaatttttttgaa
caaagtacattaagagggataactaaaataaagttatcaaaacaagtatcaaagcataaa
aaaacacttttaatatcaccttataacacaatgattaaagaagggaaaaaaatatttcaa
aacagttccggttattactatgattattatcccttaaacaacatgaaccccacaaaactg
aaagagataaaaaagctaattgaaaaacacgaacaagttatatttaatctctcaacaccc
gctagtcaacaatacatagaaaacttaaaagaatataaagacaaaataagtataattgta
tcacttacaccccaatatattaaaaacctagactggatacaaaacatagtaatagtatac
ggaacaacaatactgtcttttaaatctggattcctcactttaacagaggattttaatcca
aaaggaaaaagccccttaataaactttaagccttaa

DBGET integrated database retrieval system