KEGG   Borrelia turicatae: BT0658Help
Entry
BT0658            CDS       T00737                                 

Gene name
gpmA
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
btu  Borrelia turicatae
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:btu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BT0658 (gpmA)
   01230 Biosynthesis of amino acids
    BT0658 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BT0658 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    BT0658 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BT0658 (gpmA)
Enzymes [BR:btu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BT0658 (gpmA)
Exosome [BR:btu04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BT0658 (gpmA)
  Exosomal proteins of melanoma cells
   BT0658 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
701256..702002
Genome map
AA seq 248 aa AA seqDB search
MYKLVLVRHGESEWNKENLFTGWTDVKLSEKGISEALEGGRVLKQEGYSFDIAFSSVLVR
ANDTLNIILRELGQSYIDVEKSWRLNERHYGALQGLNKAETAEKYGEDKVLMWRRSYDIP
PMPLEESDKRHPIHDLRYRGIPKSELPSTECLKDTVARVIPYWTDKIARAIIEGKKVIIA
AHGNSLRALVKYLDNMSDDDILKLNIPTGIPLVYELDRDLRPIKHYYLGDEDKIKAAMES
VANQGKKK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtataaattagttttagtgcgtcatggtgagagtgaatggaataaagaaaatcttttt
acaggctggactgatgttaagctttctgagaagggtatttctgaagctttagagggcggt
agagttcttaaacaagaaggctattcttttgatattgcttttagttcggtattggtaaga
gctaatgatactttaaatattattttgcgtgagttgggtcaatcttatattgatgtagag
aaatcttggcgactcaatgaaagacattatggagctttgcaagggttaaataaggctgaa
acagctgaaaaatatggcgaggataaggttttaatgtggagacgtagttatgatatacct
cctatgcctttagaagagtctgataaacgtcatccaattcatgacttgagatatagaggg
atccctaaaagtgaacttccttcaacggaatgtttaaaggatactgttgcaagagttata
ccgtattggacagataaaattgctagagctattattgagggaaaaaaggttattattgct
gctcatggaaattctttaagagctcttgttaaatatcttgataatatgagtgatgatgat
attttaaagcttaatattcctactggtattcctttagtgtatgaacttgatagggattta
agacctattaaacattattacttgggtgacgaggataagattaaagcggctatggaatct
gttgctaatcaaggaaagaaaaaataa

DBGET integrated database retrieval system