KEGG   Borrelia turicatae: BT0727Help
Entry
BT0727            CDS       T00737                                 

Definition
(GenBank) pyrophosphate--fructose 6-phosphate 1-phosphotransferase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
btu  Borrelia turicatae
Pathway
btu00010  Glycolysis / Gluconeogenesis
btu00030  Pentose phosphate pathway
btu00051  Fructose and mannose metabolism
btu00052  Galactose metabolism
btu00680  Methane metabolism
btu01100  Metabolic pathways
btu01110  Biosynthesis of secondary metabolites
btu01120  Microbial metabolism in diverse environments
btu01130  Biosynthesis of antibiotics
btu01200  Carbon metabolism
btu01230  Biosynthesis of amino acids
btu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:btu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BT0727
   00030 Pentose phosphate pathway
    BT0727
   00051 Fructose and mannose metabolism
    BT0727
   00052 Galactose metabolism
    BT0727
  Energy metabolism
   00680 Methane metabolism
    BT0727
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BT0727
Enzymes [BR:btu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BT0727
Protein phosphatases and associated proteins [BR:btu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BT0727
Messenger RNA biogenesis [BR:btu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BT0727
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK Sda
Motif
Other DBs
NCBI-ProteinID: AAX18043
UniProt: A1R0F1
Position
769899..771248
Genome map
AA seq 449 aa AA seqDB search
MHRLRNKNLDFKIENLGECKQDNPLINFYADESHIHFTGEANKIRFNVYKNDEAWDQYEN
IFLEKAGPRHKIYFIPKHVKAAITTCGGLCPGFNDVIRSIVRTLWKVYGVHNIYGVKFGY
QGLLPDSNLSFVELNPDVVDDINQLGGTILGSSRGGIKPVEIVDTLERMGINMLFNIGGD
GTQKGSVLIAEEIERRNLKIAVVGIPKTIDNDFMFVQKSFGFETAVEQSVAAVAGAHFEA
NSAYNGIGLVKVMGRDSGFIAAHTALSSNDVNFCLIPELDFDIEGPNGLLEHLERRLLAK
ENLDEMPHAVILIAEGAGQKYFDPSSRKKDDSGNLLYEDIGLYIKDKINTYFKSKNISIN
LKYIDPSYLVRSSPANASDSLYCARLGSNAVHAAMAGKTKLLISLWSTKFVHIPIKMAVI
ARNKVNINGSFWRDVLASTGQPFSMKNEK
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgcatagacttaggaataagaatttagattttaaaatagaaaatttaggagaatgtaag
caagataatcctttgattaatttttatgctgatgagagtcatattcattttactggtgag
gctaataagattagatttaatgtttataaaaatgacgaggcttgggatcaatatgagaat
atttttttagaaaaagccggacctagacataaaatttattttattccaaagcatgttaaa
gcggcaattactacttgtggaggtctttgtccaggttttaatgatgttattcgttccatt
gttagaactttatggaaagtatatggagtgcataatatttatggagttaaattcggatat
cagggacttttgccagattctaatttaagttttgttgagctaaatcctgatgtagtagat
gatattaatcaacttggtggtacaatacttggttcatcaagaggaggaattaaacctgtt
gaaatagttgatactttggagagaatgggcattaatatgctctttaatatcggtggagat
ggaacacaaaaaggttctgttctaattgctgaggaaatagagaggagaaatttgaagatt
gctgttgtaggtattccaaagacaatagataatgattttatgtttgttcaaaaatctttt
ggatttgaaacagctgtagagcaatcagttgctgcagttgctggtgctcactttgaggca
aatagtgcttataatggaattggtcttgttaaagttatgggtagagattctgggtttatt
gctgctcataccgctttatcttctaatgatgttaatttttgtctgattccagaactagat
tttgatattgaggggcctaatgggcttcttgaacatcttgaaagacgacttttggcaaaa
gagaatttggatgagatgccccatgcagtaatattaatagcagagggcgcaggacaaaag
tattttgatcctagtagtcgtaaaaaagacgattctggtaacttgctttatgaagatatt
ggactttatattaaagataagattaatacgtattttaagtccaaaaatatttcaattaat
cttaagtatattgatcctagttatcttgtgagaagttctccagctaatgctagtgattct
ctttattgtgctcgtcttggttccaatgctgttcatgctgctatggcaggtaagacaaaa
ttattaattagcttgtggagtacaaaatttgtacatattccaataaaaatggcagtaatt
gccagaaataaagtcaatataaatggttctttctggagggatgttcttgcaagtaccggt
cagccatttagtatgaagaacgagaaataa

DBGET integrated database retrieval system