KEGG   Borrelia turicatae: BT0727Help
Entry
BT0727            CDS       T00737                                 

Definition
diphosphate--fructose-6-phosphate 1-phosphotransferase (EC:2.7.1.90)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
btu  Borrelia turicatae
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:btu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BT0727
   01230 Biosynthesis of amino acids
    BT0727
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BT0727
   00030 Pentose phosphate pathway
    BT0727
   00051 Fructose and mannose metabolism
    BT0727
   00052 Galactose metabolism
    BT0727
  Energy metabolism
   00680 Methane metabolism
    BT0727
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BT0727
Enzymes [BR:btu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BT0727
Protein phosphatases and associated proteins [BR:btu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BT0727
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
769899..771248
Genome map
AA seq 449 aa AA seqDB search
MHRLRNKNLDFKIENLGECKQDNPLINFYADESHIHFTGEANKIRFNVYKNDEAWDQYEN
IFLEKAGPRHKIYFIPKHVKAAITTCGGLCPGFNDVIRSIVRTLWKVYGVHNIYGVKFGY
QGLLPDSNLSFVELNPDVVDDINQLGGTILGSSRGGIKPVEIVDTLERMGINMLFNIGGD
GTQKGSVLIAEEIERRNLKIAVVGIPKTIDNDFMFVQKSFGFETAVEQSVAAVAGAHFEA
NSAYNGIGLVKVMGRDSGFIAAHTALSSNDVNFCLIPELDFDIEGPNGLLEHLERRLLAK
ENLDEMPHAVILIAEGAGQKYFDPSSRKKDDSGNLLYEDIGLYIKDKINTYFKSKNISIN
LKYIDPSYLVRSSPANASDSLYCARLGSNAVHAAMAGKTKLLISLWSTKFVHIPIKMAVI
ARNKVNINGSFWRDVLASTGQPFSMKNEK
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgcatagacttaggaataagaatttagattttaaaatagaaaatttaggagaatgtaag
caagataatcctttgattaatttttatgctgatgagagtcatattcattttactggtgag
gctaataagattagatttaatgtttataaaaatgacgaggcttgggatcaatatgagaat
atttttttagaaaaagccggacctagacataaaatttattttattccaaagcatgttaaa
gcggcaattactacttgtggaggtctttgtccaggttttaatgatgttattcgttccatt
gttagaactttatggaaagtatatggagtgcataatatttatggagttaaattcggatat
cagggacttttgccagattctaatttaagttttgttgagctaaatcctgatgtagtagat
gatattaatcaacttggtggtacaatacttggttcatcaagaggaggaattaaacctgtt
gaaatagttgatactttggagagaatgggcattaatatgctctttaatatcggtggagat
ggaacacaaaaaggttctgttctaattgctgaggaaatagagaggagaaatttgaagatt
gctgttgtaggtattccaaagacaatagataatgattttatgtttgttcaaaaatctttt
ggatttgaaacagctgtagagcaatcagttgctgcagttgctggtgctcactttgaggca
aatagtgcttataatggaattggtcttgttaaagttatgggtagagattctgggtttatt
gctgctcataccgctttatcttctaatgatgttaatttttgtctgattccagaactagat
tttgatattgaggggcctaatgggcttcttgaacatcttgaaagacgacttttggcaaaa
gagaatttggatgagatgccccatgcagtaatattaatagcagagggcgcaggacaaaag
tattttgatcctagtagtcgtaaaaaagacgattctggtaacttgctttatgaagatatt
ggactttatattaaagataagattaatacgtattttaagtccaaaaatatttcaattaat
cttaagtatattgatcctagttatcttgtgagaagttctccagctaatgctagtgattct
ctttattgtgctcgtcttggttccaatgctgttcatgctgctatggcaggtaagacaaaa
ttattaattagcttgtggagtacaaaatttgtacatattccaataaaaatggcagtaatt
gccagaaataaagtcaatataaatggttctttctggagggatgttcttgcaagtaccggt
cagccatttagtatgaagaacgagaaataa

DBGET integrated database retrieval system