KEGG   Bacillus toyonensis: Btoyo_4504Help
Entry
Btoyo_4504        CDS       T02901                                 

Definition
Tryptophan 2-monooxygenase
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
bty  Bacillus toyonensis
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
GABA biosynthesis, eukaryotes, putrescine => GABA
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:bty00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bty00330]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:bty00340]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:bty00350]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:bty00360]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:bty00380]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4434655..4436091
Genome map
AA seq 478 aa AA seqDB search
MGNPLSMEQMLQIVHEGLAKTNNPKQITVAGAGISGLVAGSLLKEAGHEVTIIEANNRIG
GRVYTIREPFSAGLYFNAGPMRIPDTHELTLAYIRKFKLPLNLFINKTFADIIYTNHIQT
RLNVFEYDPSILEYPVLDKERGKTAEELMLEVLEPILNYIKKDPNKNWFIVEKKYKTYSL
GLFLMEYYSDGAIDMIGVLLDMEAYMGMSLIEVLREMIFFTSTAKYYEITGGMDALPNAF
LPQLKDNIFMSYKVEKIIQEDNKVMLQVKHEQTLDPFTITSDIAIITIPFSALRFVEVQP
FHLFTYFKRRAIRELNYIAATKIAIEFKSRFWERVGQYGGKSITDLPIRFTYYPSYGIQS
PGAAIVIASYTWADEALTWDSLPHRERIRYALKNLAQIYGNVVYSEFITGESFSWSKNTY
SCGAFTAFEPGQELELFPYIASPAGNVHFAGEHTTLTHGWMQGAIESGIRVAHEVNEK
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggggaatccattatcgatggaacaaatgcttcaaattgttcatgaagggcttgccaaa
acgaataaccccaaacaaattacagttgccggtgcagggatttctggattagttgcaggt
tctttattgaaagaggctggacatgaagtaacgattatagaagcaaataacagaataggt
ggcagggtgtatacgattcgtgaaccgtttagtgcgggtttatactttaatgcaggaccg
atgagaattcctgatacgcatgagttaactttagcgtatattcgtaaatttaaactaccg
ttaaacctttttataaataaaacttttgcagatatcatttatacgaatcatattcaaacg
agattgaatgtgtttgaatatgatccaagtatacttgaatatccggttttggataaagaa
agaggaaaaacggcagaagagctaatgcttgaagtattagaaccaatactaaattatatt
aagaaggatcctaataaaaactggtttatcgttgaaaaaaagtataaaacgtattcgctt
ggtttatttttaatggagtattattcggatggagcaatagatatgattggtgtacttctt
gatatggaagcatatatgggaatgtctttaattgaagtattacgggaaatgatttttttt
acttcaacggcgaaatattacgagataacgggcgggatggatgcattaccaaatgcattt
ttaccacagctaaaggataatatttttatgtcctataaagtagaaaaaataatacaagaa
gataataaagtgatgctgcaagtaaaacatgaacaaacgttagatccatttacaataaca
agtgatattgctattatcacaattccgttttcggcgttacgatttgtagaagttcagcca
tttcatttattcacttattttaaaagacgagcaattcgtgaattaaattatattgctgca
actaaaattgcgatagagttcaaaagtagattttgggaaagagtcgggcagtatggtggg
aaatctattacggatttaccgatacgttttacatattatccgagctatggcattcagtca
ccaggggcagctatcgttatagcaagttatacgtgggcggatgaggctttaacatgggat
agtctcccgcatagagagcgtattcgttacgcattgaaaaatttagcgcaaatatatggg
aatgtagtctatagtgagtttataacaggggaatcttttagctggagtaagaatacgtat
tcttgcggagcatttacagcttttgaaccaggccaagagctagaattatttccttatatt
gcgtcgccggctggaaacgtacactttgcaggagaacatacaacgttgacacatgggtgg
atgcagggagcgattgagtctggaattagagttgctcatgaagtaaatgaaaagtga

DBGET integrated database retrieval system