KEGG   Bacillus toyonensis: Btoyo_4587Help
Entry
Btoyo_4587        CDS       T02901                                 

Definition
Tryptophan 2-monooxygenase
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
bty  Bacillus toyonensis
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:bty00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Btoyo_4587
   00330 Arginine and proline metabolism
    Btoyo_4587
   00340 Histidine metabolism
    Btoyo_4587
   00350 Tyrosine metabolism
    Btoyo_4587
   00360 Phenylalanine metabolism
    Btoyo_4587
   00380 Tryptophan metabolism
    Btoyo_4587
Enzymes [BR:bty01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     Btoyo_4587
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4520417..4521880
Genome map
AA seq 487 aa AA seqDB search
MQKDLMYNTKMDETLQVINKGLNKTTRPKQIIVVGAGMAGLVSASLLKAAGHEVKIFEAN
NRVGGRIETVRMEDTGLYLDVGAMRIPYSHTLTMAYIRKFGLQVSPFINRNETDIIYVNG
RKTTLKQYEKDPSILRYPVEMNEVGKTSEELLLLAVQPIINFIKKNPEKNWDVVVKDFGR
YSTGQFLKYHPYQYNTYFSPITIEMIGVLLDLEGFLERSFVETLRFLYIMQEESGFCEII
GGNDRLPKSFLPQLEENIIYNQKLMKLHQHDNGVTAFYRNEETFEYSSITGDLVIVTIPF
STMRFVEVDPFDSISHEKWKAIRELHYMPATKIGIQFKSRFWEEQGQLGGRIITDLPIRY
AYYPSHGIGQKGPAMMLGSYTWSYDALLWDGLSKGDRIYYTLHNLATILGGQVYDEFMSG
ISKSWTLDPYALGGFALFQAGQESELQPAIVKPEGKIFFAGDHTTLYHGWIQGAIESGVR
VAVEVNE
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
gtgcagaaagacttaatgtataacactaagatggatgaaacgttacaagttataaataag
ggattgaataagacgacacgtccgaaacaaattattgtagtaggggcaggcatggctgga
ttagtttcggcatctttattaaaggctgcaggacatgaagtgaagatttttgaagcaaac
aatcgtgtaggcggccgcatagagacagttagaatggaagataccggattatatttagat
gttggggcgatgagaattccatattcgcacacgttaacgatggcatatataagaaagttt
gggttacaggtgagtccttttattaataggaatgagacagatatcatctacgtaaatggt
cggaaaacgacattaaaacaatatgaaaaagatccaagtattttaagatatcctgtggaa
atgaatgaagttgggaaaacgtctgaggaactattattgttagcggtacagcccattata
aattttataaaaaagaacccagagaaaaattgggatgttgtagtaaaggattttggaaga
tactctacaggacaatttttaaagtaccatccttatcaatataatacgtatttttcacca
ataacgattgagatgattggtgttttattagatttagaaggttttttagaaaggtcattc
gttgagacgttacgttttttatacattatgcaagaggagagcggattttgtgaaataata
ggtggaaacgatagattaccaaaatcttttttaccgcaattagaagaaaatattatttat
aatcaaaaattaatgaagctacatcaacacgataacggtgtgacagctttctatcgaaac
gaggaaacttttgaatatagtagtattacaggggatttagttattgttacaattccgttt
tcgacaatgcgttttgtggaagtagatccatttgactctatatctcatgaaaagtggaaa
gcaattcgtgaattgcattatatgcctgcgacgaaaataggcattcaatttaaaagtcga
ttttgggaagaacaagggcaattaggtggcagaattataacagatttgccaattcgttac
gcctattatccaagccatggaattggacagaaaggaccagctatgatgttaggaagctat
acatggtcttatgatgcgttgctatgggatgggttatcgaagggtgatcgtatttattac
acattacacaacttagcaacgatattaggtggtcaagtatatgatgaatttatgtctgga
atatcaaaaagttggacattggatccatatgcacttggaggatttgctctttttcaagcc
ggtcaagaatctgagctacaaccagcgattgtaaagccagaggggaaaatattctttgct
ggagatcatacaacgttatatcacggatggattcaaggtgcgattgagtctggagttcgt
gtagcggtggaagtgaatgagtaa

DBGET integrated database retrieval system