KEGG   Burkholderia thailandensis H0587: BTL_24Help
Entry
BTL_24            CDS       T03113                                 

Definition
alkaline phosphatase family protein
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
btz  Burkholderia thailandensis H0587
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:btz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BTL_24
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BTL_24
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BTL_24
Enzymes [BR:btz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BTL_24
Exosome [BR:btz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BTL_24
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
1:complement(27847..29247)
Genome map
AA seq 466 aa AA seqDB search
MSTIKRIAAAFAAAALSGGVGQAAHAAGQAKNVIFFLGDGMGPATVTASRLYKVGEAGQL
TMETLPRTVRIKTFSNDAQTTDSAPSMAAYMTGVKMNNEVLSMSPDTRAVAPGSDANGNK
TVNNCGANNGKPVATLLELAKARGKAVGAITTTELTHATPAATYSHICHRDAQYDIAAQA
VPGGAGYNAALGDGVDVLMGGGRNHWTPYDPVANKRGRADGRNLLAELQAKGYAVAATKD
QLAQAGGGKLIGLFSATSHLEYELDRVAGKGEGATQPSLAEMTAKAIDVLRKNPNGYFLM
VEGGRIDHALHGTNAKRALEDTVAFDEAIRTALAKVDLSNTLIVVTADHDHTLTINGYAK
RGNPVLDISRSYRDGQPNRDADGNTYTTLVFGNGANRPNVRTPVDSASATNEAYLQEVGV
RMGGAGSETHGGGDVMLFADGADAKAFKGTLDNTKVFGLVKSAFGF
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactatcaagcgcatcgcagcggcgttcgccgcggcggccctttcgggcggtgtc
ggccaggcggcgcacgccgcgggccaggcgaagaacgtgatcttcttcctcggcgacggg
atggggccggccaccgtgacggcgagccgcctctacaaggtcggcgaggccggccaactg
acgatggagacgctgccgcgcaccgtgcgcatcaagactttctcgaacgacgcgcagacc
accgacagcgcgccgtcgatggccgcgtacatgaccggcgtgaagatgaacaacgaggtg
ctgtcgatgtcgccggacacgcgcgcggtcgcgcccggcagcgacgcgaacggcaacaag
acggtgaacaactgcggcgcgaacaacggcaagccggtggcgacgctgctcgagctcgcg
aaggcgcggggcaaggcggtcggcgcgatcacgacgaccgagctcacgcatgcgacgccc
gccgcgacgtactcgcacatctgccatcgcgatgcgcagtacgacatcgccgcgcaggcg
gtgccgggcggcgcgggctacaacgcggcgctcggcgacggcgtcgacgtgctgatgggc
ggcggccgcaatcactggacgccgtacgatccggtcgcgaacaagcgcggccgcgcggac
gggcgcaatctgctcgccgagctgcaggcgaagggctacgcggtcgcggcgacgaaggac
cagctcgcgcaggcgggcggcggcaagctgatcgggctcttcagcgcgacgagccatctc
gagtacgagctcgatcgcgtcgcgggcaagggcgagggcgcgacgcagccgagccttgcg
gagatgaccgcgaaggcgatcgacgtgttgcggaagaatccgaacggctatttcctgatg
gtcgaaggcgggcgcatcgatcacgcgctgcacggcacgaacgcaaagcgcgcgctcgaa
gacacggtggcgttcgacgaggcgattcgcaccgcgctcgcgaaggtcgatctgtcgaac
acgctgatcgtcgtgacggccgaccacgaccacacgttgacgatcaacggctatgcgaag
cgcggcaatccggtgctcgacatcagccgcagctatcgcgacggccagccgaaccgggac
gcggacggcaacacgtatacgacgctcgtgttcggcaacggcgcgaatcgcccgaacgtg
cgcacgccggtggattcggcgagcgcgacgaacgaagcgtacctgcaggaagtcggcgtg
cggatgggcggcgcgggctccgagacgcacggcggcggggacgtgatgctgttcgccgac
ggcgccgacgcgaaggcgttcaagggcacgctcgacaacacgaaggtgttcggcctcgtg
aaatcggcgttcgggttttga

DBGET integrated database retrieval system