KEGG   Burkholderia thailandensis H0587: BTL_2822Help
Entry
BTL_2822          CDS       T03113                                 

Definition
phosphoenolpyruvate carboxylase family protein
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
btz  Burkholderia thailandensis H0587
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:btz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BTL_2822
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BTL_2822
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BTL_2822
   00680 Methane metabolism
    BTL_2822
Enzymes [BR:btz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BTL_2822
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
1:3181891..3184875
Genome map
AA seq 994 aa AA seqDB search
MKSSGSARATRRNAVSSSSAPANAELPARRAAKTVRKPNGAAARTIAPTNAASAKPHGRT
REDKDRPLFEDIRYLGRLLGDVVREQEGDAVFDVVETIRQTAVKFRREDDKAAAQTLEKM
LRKLTPEQTVSVVRAFSYFSHLANIAEDRHHNRRRRIHALAGSAPQAGTVAYALDKLRQA
GDASSKTIKQFFEGALIVPVLTAHPTEVQRKSILDAQHDIARLLAERDQPLTARERAHNE
ALLRARVTTLWQTRMLRDARLTVADEIENALSYYRATFLDELPALYTDIEEALAEHGLPA
RVPAFFQMGSWIGGDRDGNPNVTAATLDEAINRQAAVIFEHYLEQVHKLGAELSVSNLLV
GASDALKALAAASPDQSPHRVDEPYRRALIGVYTRLAASARVRLGEGAVPVRSAGRGAAP
VRATPYADAEEFVADLRVLTDSLAVHHGESLATPRLAPLMRAAEVFGFHLASIDLRQSSD
IHEAVIAELLARGGVEPDYAALPEADKLRVLLAALADPRPLRSPYLDYSDLAKSELGVLE
RAHAIRAQFGARAVRNYIISHTETVSDLVEVLLLQKETGLFEGTLGAPHANARNGLMVIP
LFETIADLRNASDIMREFFALPGVGELLAHQGHEQEVMLGYSDSNKDGGFLTSNWELYRA
ELALVDLFHERGIKLRLFHGRGGTVGRGGGPTYQAILSQPPGTVNGQIRLTEQGEVIASK
FANPEIGRRNLETVVAATLEATLAPHSNAPKQLPAFEAAMQTLSDAAMASYRALVYETPG
FTDYFFSSTPITEIAELNIGSRPASRKLQDPKHRKIEDLRAIPWGFSWGQCRLLLTGWYG
FGGAVAAYLDGAPDAAERGKRVALLRKMNKTWPFFANLLSNMDMVLAKTDLAVASRYAQL
VADKKLRKHVFERIVAEWHRTASALAEITGAQARLAANPLLARSIKNRFPYLDPLNHLQV
ELIKRHRAGDTNARLRRGIHLTINGIAAGLRNTG
NT seq 2985 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtcttccggatcggcgcgcgcgacgcgccgcaatgctgtctcgtcctcctccgcc
ccggcgaacgccgagctccccgcccgccgcgccgcgaaaaccgtgcgcaagcccaacggc
gccgccgcgcgcacgatcgcgccgacgaatgccgcatccgcgaaaccgcacggccgcacg
cgcgaagacaaggatcgcccgctgttcgaggacatccgctatctgggccgcctgctcggc
gacgtcgttcgcgagcaggaaggcgacgccgtattcgacgtcgtcgagacgatccgccag
accgccgtcaagttccgccgcgaggacgacaaggccgccgcgcagacgctcgagaagatg
ctgcgcaagctcacgcccgagcagacggtgagcgtcgtgcgcgcgttcagctatttctcg
cacctcgcgaacatcgccgaggaccgccaccacaaccgccgccgcagaatccacgcgctc
gcgggctccgcgccgcaggcgggcaccgtcgcgtacgcgctcgacaagctcaggcaggcg
ggcgacgcgtcgtcgaagacgatcaagcagttcttcgagggcgcgctgatcgtgcccgtg
ctgaccgcgcacccgaccgaagtgcagcgcaagagcattctcgacgcgcagcacgacatc
gcgcggctgctcgccgagcgcgaccagccgctcaccgcgcgcgagcgcgcgcacaacgag
gcgctgctgcgcgcgcgcgtgacgacgctctggcagacccggatgctgcgcgacgcgcgg
ctcaccgtcgccgacgagatcgagaatgcgctgtcgtactaccgcgcgacgttcctcgac
gagctgcccgcgctctacacggacatcgaggaggcgctcgccgagcacggcctgcccgcg
cgcgtgccggcgttcttccagatgggcagctggatcggcggcgaccgcgacggcaacccg
aacgtcaccgccgcgacgctcgacgaggcgatcaatcgccaggcggcggtgatcttcgag
cattacctggaacaggtgcacaagctgggcgcggagctctccgtgtcgaacctgctcgtc
ggcgcgagcgacgcgctgaaggcgctcgcggccgcgtcgccggaccagtcgccgcaccgc
gtcgacgagccgtaccgccgcgcgctgatcggcgtctacacgcggcttgcggcaagcgcg
cgcgtgcggctcggcgaaggcgcggtgcccgtgaggagcgcgggccgcggcgccgcgccc
gtgcgcgccacgccgtatgcggacgccgaggaattcgtggccgacctgcgcgtgctgacc
gattcgctcgccgtgcatcacggcgaatcgctcgcgacgccgcgcctcgcgccgctcatg
cgcgcggccgaggtgttcggctttcatctcgcgagcatcgacttgcggcagagctcggac
atccatgaagcggtgatcgccgagctgctcgcgcgcggcggcgtcgagcccgactacgcg
gcgctgcccgaagcggacaagctgcgcgtgctgctcgcggcgctcgcggacccgcggccg
ctgcgctcgccgtatctcgactactcggacctcgcgaagagcgagctcggcgtgctcgag
cgcgcgcacgcgatccgcgcgcagttcggcgcgcgcgcggtgcgcaactacatcatttcg
cataccgagacggtgagcgacctcgtcgaagtgctgctgctgcagaaggaaacgggcctc
ttcgagggcacgctcggcgcgccgcacgcgaacgcgcgcaacggcctgatggtgattccg
ctcttcgagacgatcgccgacctgcgcaacgcgtccgacatcatgcgcgaattcttcgcg
ctgccgggcgtgggcgagctgctcgcgcaccagggccacgagcaggaagtgatgctcggc
tattcggacagcaacaaggacggcggcttcctcacgtcgaactgggagctctaccgcgcg
gaactggcgctcgtcgatctgttccacgagcgcgggatcaagctgcgcctgttccacggc
cgcggcggcacggtgggccgcggcggcggcccgacctatcaggcgatcctgtcgcagccg
cccggcacggtgaacggccagatccggctcaccgagcagggcgaggtgatcgcgagcaag
ttcgcgaaccccgagatcggccggcgcaatctggagacggtcgtcgccgcgacgctcgag
gcgacgctcgcgccgcacagcaacgcgccgaagcagttgccggcgttcgaggcggcgatg
cagacgctgtcggatgcggcgatggcgtcgtaccgcgcgctcgtctacgagacgcccggc
tttaccgactacttcttctcgtcgacgccgatcaccgagatcgccgagctgaacatcggc
agccgccccgcgtcgcgcaagctgcaggacccgaagcaccgcaagatcgaggatctgcgc
gcgattccgtggggtttctcgtggggccagtgccgcctgctgctgacgggctggtacggc
ttcggcggcgcggtagccgcgtatctcgacggcgcgccggacgcggccgagcgcggcaag
cgcgtcgcgctgctcaggaagatgaacaaaacctggccgttcttcgcgaacctgctgtcg
aacatggacatggtgctcgcgaagaccgatctcgcagtcgcgtcgcgctacgcgcagctc
gtcgccgacaagaagctgcgcaagcacgtgttcgagcggatcgtcgccgaatggcaccgc
acggcgagcgcgctcgccgagatcaccggcgcgcaagctcggctcgccgcgaatccgctc
ctcgcgcgctcgatcaagaaccgcttcccgtacctcgatccgctgaaccacctgcaggtc
gagctgatcaagcggcaccgcgcgggcgacacgaacgcgcggctgcggcgcgggatccac
ctgacgatcaacgggatcgcggccggcctgcgcaatacgggctga

DBGET integrated database retrieval system