KEGG   Buchnera aphidicola LL01: CWO_00710Help
Entry
CWO_00710         CDS       T01828                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bua  Buchnera aphidicola LL01
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bua00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:bua00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(149154..149639)
Genome map
AA seq 161 aa AA seqDB search
MNISLIAAISKNLVIGYKNKIPWYLPEDLKWFKQKTINKNIIMGRLTWESIKKKPLPMRK
NIVISSNEIKQEGIIWADSISNAIISAQYNQEIMIIGGAKIYKEMLFYANKLYLTHIDID
IVGDAYFPEYKLYPYWKTLFRKKNTKNKMNPYNYSFEILSR
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgaatataagtttaattgctgctatatctaaaaatttagttatcggatataaaaataaa
ataccttggtatcttccagaagatttaaaatggtttaaacaaaaaacgattaataaaaac
ataattatgggtcgattaacttgggagtctattaaaaaaaaacccttaccaatgcgtaaa
aacatagttattagtagcaatgaaatcaaacaagagggtattatttgggctgattcaata
tctaatgcaattatatctgcacaatacaatcaagaaattatgattattggtggtgctaaa
atatataaagaaatgctattttatgctaataaattatatttaactcatatagatattgat
attgttggtgatgcttattttcctgaatataagttatatccatattggaaaacattattt
agaaaaaaaaataccaaaaataaaatgaatccatacaattattcatttgaaattttatca
agataa

DBGET integrated database retrieval system