KEGG   Buchnera aphidicola LL01 (Acyrthosiphon pisum): CWO_01050Help
Entry
CWO_01050         CDS       T01828                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bua  Buchnera aphidicola LL01 (Acyrthosiphon pisum)
Pathway
bua00010  Glycolysis / Gluconeogenesis
bua00020  Citrate cycle (TCA cycle)
bua00620  Pyruvate metabolism
bua01100  Metabolic pathways
bua01110  Biosynthesis of secondary metabolites
bua01120  Microbial metabolism in diverse environments
bua01130  Biosynthesis of antibiotics
bua01200  Carbon metabolism
Module
bua_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bua00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CWO_01050
   00020 Citrate cycle (TCA cycle)
    CWO_01050
   00620 Pyruvate metabolism
    CWO_01050
Enzymes [BR:bua01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CWO_01050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: ADP66030
Position
226522..227730
Genome map
AA seq 402 aa AA seqDB search
MDIEVKMPDIGLEEVEIIEILVSINEKIAPEQGLITVEGDKTSMEIPSPISGIVKHIFIK
IGEKIKTDALIMRCEVENIDFHVKKKEEICLDNNVLNKVEKNFKKDIFFHATPLIRRLAR
NLNINLYDVVGTGPKNRILKEDLDLYQSNIKENLIEEKNKINFGDSKKSKTKELELSDIQ
KNIGNNLHRNWMNIPHVTQFDEVDITILEKFRQKYNNEKRNQKKTNENITILVFIIKVVA
YALEKFPIFNSSLNINNKKIILKKYINIGFAIDVNNDLFVPVLKDVNKKNIKQLSSELIL
LSEKARTKKLNIEDMTGGCFTISNLGGIGGSWFSPIINSPEVAILGISKSQIKPSWNGKE
FIPSLMLPLSLSYDHRVINGAYAARFITFISRVLSDMHFLIM
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
gtggatatagaagtcaaaatgcctgatattggtttagaagaagtagaaataattgaaata
ttagtaagtattaatgaaaaaatagcaccagaacaaggattaataactgtggaaggagat
aaaacttctatggaaataccttcacctatatcaggtattgtaaagcatatcttcattaaa
attggcgaaaaaattaaaactgatgctcttatcatgagatgtgaagtggagaatattgat
tttcatgtaaagaaaaaagaagaaatttgtttagataataatgttttaaataaggttgaa
aaaaatttcaaaaaagatattttttttcatgcaactccattaataagacgtttagctcga
aatttaaatataaatttatacgatgttgttggtaccggacctaaaaataggattttaaaa
gaagatttagatctatatcaaagtaatattaaagagaatcttatagaagaaaaaaataaa
attaattttggtgattctaagaaatcaaaaacaaaagaattagaattaagtgatatccag
aaaaatattggtaataatttacatcggaattggatgaatatacctcatgttacacaattt
gatgaagttgatattactatattagaaaagtttcgtcaaaaatataataacgaaaagaga
aatcaaaaaaaaacaaatgaaaatattacaattttagtttttataataaaagtagttgca
tatgcattagaaaaattccctatttttaacagttcactaaatattaataataaaaaaatt
attttaaaaaaatatattaatatcggttttgcaatagatgtaaataacgatttatttgtt
cctgttttaaaagacgtcaataaaaaaaatattaaacaattatcttctgaattaatattg
ctatcagaaaaagcacgaacaaaaaaattaaatattgaagatatgacaggaggctgtttt
acaatatctaatttaggaggtattggaggaagctggttttcaccaattatcaattcaccg
gaagtagcaattcttggtatttcaaaatctcagataaaaccgtcatggaatggaaaagaa
tttattccttctttaatgttaccattatctttatcttatgatcatcgtgtaataaatggt
gcttatgcagcgcgttttattacatttattagtagagttttatcagatatgcatttttta
attatgtag

DBGET integrated database retrieval system