KEGG   Buchnera aphidicola LL01 (Acyrthosiphon pisum): CWO_01585Help
Entry
CWO_01585         CDS       T01828                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bua  Buchnera aphidicola LL01 (Acyrthosiphon pisum)
Pathway
bua00010  Glycolysis / Gluconeogenesis
bua00260  Glycine, serine and threonine metabolism
bua00680  Methane metabolism
bua01100  Metabolic pathways
bua01110  Biosynthesis of secondary metabolites
bua01120  Microbial metabolism in diverse environments
bua01130  Biosynthesis of antibiotics
bua01200  Carbon metabolism
bua01230  Biosynthesis of amino acids
Module
bua_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bua00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CWO_01585 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    CWO_01585 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CWO_01585 (gpmA)
Enzymes [BR:bua01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CWO_01585 (gpmA)
Membrane trafficking [BR:bua04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    CWO_01585 (gpmA)
Exosome [BR:bua04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CWO_01585 (gpmA)
  Exosomal proteins of melanoma cells
   CWO_01585 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 MAF_flag10
Motif
Other DBs
NCBI-ProteinID: ADP66123
Position
338391..339086
Genome map
AA seq 231 aa AA seqDB search
MKINQVVLIRHGQSEWNTLNKFTGWHDAELDKKGKDEAKFAAILLKKEKFFFDCAHTSLL
KRAIHTLQYILDELNQTWLSVKKSWRLNERHYGALEGLNKDEVIEKYGQKQVLLWRRSFD
ISPPQINIKDKRFPGNDPRYSHLNIHDIPLGESLEKTAKRVIPYWNKIIYPELKNNKKIL
IVAHGNSLRALIQHLYKIDNKAILDLNIPTAQPIILDFDNEKNPIKWHYLT
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaatcaagtagttttaattagacatggtcaaagcgaatggaatacattaaat
aaatttactggttggcatgatgccgaattagataaaaaaggaaaagatgaagctaaattt
gctgctatcttattaaaaaaagaaaaatttttttttgattgcgcacatacatcattatta
aaaagagcaattcatactttgcaatatattttagatgaattaaaccaaacctggttgtca
gttaaaaaatcctggcgtttaaacgaacgacattatggtgcattagaagggttaaataaa
gatgaagttattgagaaatatggacaaaaacaagttcttctatggagaagaagttttgat
attagtccacctcagattaatataaaagataaacgctttccaggaaacgatccacgctac
tctcatttaaatattcatgacatccctctaggagagagcttagaaaaaactgcaaaacga
gttattccttattggaacaaaattatttatccagaattaaaaaataataaaaaaatactt
attgtagcgcatggaaattctttacgtgccttgatacaacacttatataaaatagacaat
aaagctattttagatttaaatattcctactgcacaacccattatcttagatttcgataat
gaaaaaaatccaattaaatggcactatttaacataa

DBGET integrated database retrieval system