KEGG   Buchnera aphidicola LL01 (Acyrthosiphon pisum): CWO_01590Help
Entry
CWO_01590         CDS       T01828                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bua  Buchnera aphidicola LL01 (Acyrthosiphon pisum)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bua00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CWO_01590
   01230 Biosynthesis of amino acids
    CWO_01590
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CWO_01590
   00030 Pentose phosphate pathway
    CWO_01590
   00051 Fructose and mannose metabolism
    CWO_01590
   00052 Galactose metabolism
    CWO_01590
  Energy metabolism
   00680 Methane metabolism
    CWO_01590
Enzymes [BR:bua01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CWO_01590
Protein phosphatases and associated proteins [BR:bua01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CWO_01590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
339269..340231
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRTALSERLEVFGIYDGYLGLYENRMVQLDRYSVSD
MINRGGTFLGSARFASFYQDKIRSIAVQNIKKRKIDALVVIGGDGSYIGAQKLTEMGIPC
ISIPGTIDNDVSGTDYTIGYFTALQTVVEAIDRLRDTSSSHQRISIVEVMGRHCGDLTLA
AAIAGGCEFIVLPEIDYKKEDLVIEIQAGIAKGKKHAIVAITEYICDVEELAQYIEKKTN
RETRATILGHIQRGGAPVVYDRILASRMGAYSVELLIKGYQGKCVGIQNEKMVFNDIKNA
LKNMKRTFKKDWLITAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaaattggagttttaactagtggtggcgatgctccagggatgaatgccgca
attagaggggttgttagaacagcacttagtgaaagattagaagtatttggaatttatgat
ggatatttaggtctatatgaaaaccgtatggtgcaacttgatagatatagtgtatctgac
atgattaacagaggtgggacatttttagggtcagctagatttgctagtttttatcaagac
aaaatacgctcaattgcagtgcaaaatataaaaaaaagaaaaatagatgctcttgttgtc
attggaggtgatggttcttatataggagctcaaaaattaacagaaatgggtattccatgt
attagcattccaggtactatagataatgatgtttcaggtactgattatacaataggttat
tttacagctttacaaacagtggttgaagctattgatcgattgcgcgacacttcttcttct
caccaacgtatttctattgtagaggtgatgggtagacattgtggagatttaacattagct
gcagctattgctggtggatgcgaatttattgttttaccagaaattgactataaaaaagaa
gatctagttatcgagattcaagctggcattgctaagggcaaaaaacatgctattgttgcc
ataactgaatacatttgtgatgtagaagaattagcacaatatattgaaaaaaaaactaat
cgagaaactagagcgacaattcttggacatatccaaagagggggtgcacctgtagtatat
gatcgtatattagcatcaagaatgggtgcatattcagttgaattattaataaaaggttat
cagggaaaatgtgttggaatacaaaatgaaaaaatggtttttaacgatataaaaaacgca
ctaaaaaatatgaaacgtacttttaaaaaagattggttgattactgctaaaaagttatac
taa

DBGET integrated database retrieval system