KEGG   Buchnera aphidicola APS (Acyrthosiphon pisum): BU235Help
Entry
BU235             CDS       T00036                                 

Gene name
dxr
Definition
(RefSeq) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
buc  Buchnera aphidicola APS (Acyrthosiphon pisum)
Pathway
buc00900  Terpenoid backbone biosynthesis
buc01100  Metabolic pathways
buc01110  Biosynthesis of secondary metabolites
buc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:buc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BU235 (dxr)
Enzymes [BR:buc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     BU235 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Semialdhyde_dh
Motif
Other DBs
NCBI-GeneID: 1109678
NCBI-ProteinID: NP_240064
UniProt: P57329
Position
258691..259887
Genome map
AA seq 398 aa AA seqDB search
MKKITILGSTGSIGINALSIIQKNPDLFKVIALVANKNFSIMLRQCELFSPDWVAMRDEK
SAHILRKKLKHSKINTQVLTGEKDICALAALEETDHVISAIVGMAGLLPTLSAIHAGKTI
LLANKESLITSGYFFMKALSSSGAKIIPIDSEHNAIFQVLPLEIQKNLGKTTLEKNSIKH
LVLTGSGGPFYKFSSSDLSNVTPDQACSHPNWLMGKKISVDSATMMNKGLEYAEARWLFN
ALESEIKILIHPESIIHSMVQYYDGSLLAQLSVPDIRTSISYAMSWPDRICTEVDYLNFY
KINNLTFFEPDFTQFPCLKLAIDAFSQGQASMTVLNAANEIAVSSFLDSKISFTKIYEIN
MEILMSSCFSEPKCIQDILEIDRKVRILAKNKVSSLIF
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatcactattttaggatctactggttccattggtattaacgcgctatctatt
attcaaaaaaatccagatttatttaaggtaattgctttagtagctaataaaaatttttct
attatgttacgtcaatgtgagttattttctcctgattgggtggctatgagagacgagaaa
tctgctcatatattaagaaaaaaattaaaacatagtaaaatcaatactcaagttcttact
ggagaaaaagatatttgtgcgttagctgcattagaagaaacagatcacgttatatctgca
attgttggaatggctggtttgttaccgacgttatctgcaatacatgctggcaaaacaata
ttattagctaataaagaatctttaattacaagtggttatttttttatgaaagcactttct
tcaagtggcgcgaaaattattcctattgatagcgaacataatgctatttttcaagtgtta
cctttagaaattcaaaaaaacttaggtaaaactactctagagaaaaatagtatcaagcat
cttgttttaactggttctggaggtccgttttataaattttcttcatctgatttatctaat
gtgactccagatcaagcttgttctcatcccaattggttgatgggaaaaaaaatttctgta
gattcagctactatgatgaataaaggtttagaatatgctgaagcaagatggttatttaat
gctttggaatcagaaattaaaattttaattcatcctgaatcaattattcattctatggtg
cagtattatgatggttctttattagcacaattatcagtacctgatataagaacatctatt
tcatatgcaatgtcttggcctgaccgtatttgcacagaagttgattatttaaatttttat
aaaataaataatctaacttttttcgaacctgattttactcagtttccatgtctaaagtta
gctattgatgctttttctcaagggcaggcttctatgacagttttgaatgccgctaatgaa
attgccgtgtcatcttttctcgattctaaaatttcttttactaaaatttatgaaataaat
atggaaatattaatgtcttcctgtttttccgaaccaaagtgtattcaagacattctagaa
attgacagaaaagtaagaatattagcaaaaaataaagtatcatctttaattttttaa

DBGET integrated database retrieval system