KEGG   Buchnera aphidicola APS (Acyrthosiphon pisum): BU242Help
Entry
BU242             CDS       T00036                                 

Gene name
argS
Definition
(RefSeq) arginyl-tRNA synthetase
  KO
K01887  
arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
buc  Buchnera aphidicola APS (Acyrthosiphon pisum)
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:buc00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    BU242 (argS)
Enzymes [BR:buc01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     BU242 (argS)
Amino acid related enzymes [BR:buc01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   BU242 (argS)
Transfer RNA biogenesis [BR:buc03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BU242 (argS)
 Prokaryotic Type
   Other AARSs
    BU242 (argS)
Mitochondrial biogenesis [BR:buc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BU242 (argS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(271888..273612)
Genome map
AA seq 574 aa AA seqDB search
MNLKNTIKEDIQDALIKIAIINCDPVITLNKKTKIGHYQLNNLIKIANISNLKPFELANR
IILNIKKKYMYKEITFSQPGFINFLINPYWISEQLEKIFLSPRLGINHVNAQNIVIDYSS
PNIAKEMHIGHLRSTIIGDVMARILDFLGHNVIRANHIGDWGTQFGMLIAYLEVKKLVNS
PLSLMKLEEYYCKAKKKYDIDQLFAEKSREYVVKLQNGDQYCYSIWKKLVSITMLENCKI
YKRLHVTLKKKHTMGESIYNKMLPNIIEDLKNKKIAIEKNGSTIVFLKEFKNRLGEPMGV
VIQKKDKGFLYSTTDIACLKYRYQVLHADRIIYYTDSRQHQHLLQAWTIAKKALYISQNL
LLEHHIFGMMLSKDKRPFKTRDGDTIKLSALLDEATERAMRLIKNKQPNLSKKKLNQLSN
IIGVGAVKYADLSKNRNTNYIFDWNEMLSFEGNTAPYIQYAYTRIVSILKKSNMPIKKLK
EKIFLTKESEINLAIKILEFEEIILLISQKGTPHILCKYLYHLATSFSHFYENCSILFPK
KIKTCKSRLKLSILTAKTLKKGLNMLGIRVVKKM
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgaacttgaaaaatacaatcaaagaagatatccaagatgctttaattaaaattgctatc
ataaactgcgatcccgttattacattaaataaaaaaacaaaaatagggcattaccaactt
aacaatctaataaaaatagctaatatatcaaacttaaaaccatttgaattagctaataga
ataattctcaatattaaaaaaaaatacatgtataaagaaataacattctctcaaccaggt
tttattaattttcttattaatccatattggatatctgaacaattagaaaaaatttttctt
tcacctcgtcttggcataaatcacgtaaatgcacaaaatattgtaatagattattcttcg
ccaaatattgcaaaagaaatgcatattggacatttacgttcaacaataattggcgatgtt
atggctagaatattagattttttaggtcataatgtaattagagcaaatcatattggtgac
tggggtactcaatttggtatgttgattgcatatttagaagttaaaaaactcgtaaatagt
cctttatcccttatgaaattagaggaatactactgcaaggcgaaaaaaaaatatgatatt
gatcaattatttgcagaaaaatctagagaatacgtagtaaaattacaaaatggtgatcaa
tattgttattctatttggaaaaaattagtatccatcacaatgttagaaaattgtaaaata
tataaaaggctacatgttactttaaaaaaaaaacatacaatgggagagagtatatacaat
aaaatgcttcctaatattattgaagatcttaagaataaaaaaatagcaatagaaaaaaac
ggttctacaattgtttttttaaaagaattcaagaatagattaggagaacccatgggtgtt
gttattcagaaaaaagacaaagggtttttatattctactactgatatcgcttgtttaaaa
tatagatatcaagtattacatgccgatcgtattatatattacactgattctcgacagcac
cagcatttactacaagcgtggactatagccaaaaaagctctttatatatctcaaaattta
ttattagaacatcatatctttggaatgatgctatcaaaagataaacgtccatttaaaact
cgtgatggtgatactataaaactttctgcacttcttgatgaagctacagaaagggcgatg
cgtttaattaaaaataaacaacctaacttatctaaaaaaaaactaaatcaattatctaat
atcatcggtgtcggcgcagtcaaatacgcagatttatctaaaaatagaaatactaattat
atatttgattggaacgaaatgttaagctttgagggtaatacagcgccctatatacagtat
gcttatacaagaattgtttctattttaaaaaaatctaatatgcctataaagaaactaaaa
gaaaagatttttttaacaaaagaaagcgaaattaatctagcaattaaaatattagaattt
gaagaaatcattttattaatttctcaaaaaggaacccctcatattttatgtaagtatctt
tatcatcttgcaactagtttttctcatttttatgagaattgttctatactttttcccaaa
aaaataaaaacttgtaaaagtagacttaaattatctattttaacagctaaaacattaaaa
aaaggacttaatatgcttggtattagagtagtaaaaaaaatgtaa

DBGET integrated database retrieval system