KEGG   Buchnera aphidicola APS (Acyrthosiphon pisum): BU278Help
Entry
BU278             CDS       T00036                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
buc  Buchnera aphidicola APS (Acyrthosiphon pisum)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:buc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BU278 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BU278 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BU278 (trpB)
Enzymes [BR:buc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BU278 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(302760..303926)
Genome map
AA seq 388 aa AA seqDB search
MTLLNPYFGEFGGMYVPQILMPALFELEKNFVSAQKDAEFQKKFFYLLQNYAGRPTPLTL
CKNLTKGTKTKIYLKREDLLHGGAHKTNQVLGQAMLAIRMKKKEIIAETGAGQHGVASAI
ACALFNLKCRIYMGIKDIKRQNTNVFRMKLMGAEVISVKNGSGTLKDACNEALRDWSSSY
KKSHYMIGTAAGPHPYPTIVREFQKMIGEETKKQILEKENKLPDSIIACIGGGSNAIGIF
SDFINDKVNLIGVEPAGYGIHTGKHGAPLKHGRTGIYFGMKSHLMQNKQGQIQESWSISA
GLDFPSVGPEHAWLNSINRAKYVSITDEEAISAFQVLSRKEGIIPALESSHALAYALKLM
KKDPTIEQILIANLSVVEIKIFLQYMMF
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgactttactaaatccttattttggtgagtttggcggtatgtacgttccacaaatatta
atgccagctttatttgaattggaaaaaaattttgtttccgcgcaaaaagatgctgaattt
caaaaaaaatttttttatttattacaaaactatgctggcagacctactccattaactcta
tgtaaaaatttaaccaaaggaacaaaaacaaaaatttatcttaaaagagaagatttacta
catggtggagcacataaaactaatcaagtattaggtcaagctatgttagcaattagaatg
aaaaagaaagaaattattgctgaaacaggtgctggacaacatggtgtagcttctgcaatt
gcttgtgcactatttaatttaaaatgtagaatttacatgggaattaaagatattaaaaga
caaaacacaaatgtgtttcgtatgaaattaatgggtgcagaagtcatctcagttaaaaac
ggttctggaacactaaaagacgcatgtaatgaagctttacgcgattggtctagtagttat
aaaaaatctcattatatgattggtactgcagctggaccacatccctatcccactattgtt
cgtgaatttcaaaagatgattggggaagaaacaaaaaaacaaattttagaaaaagaaaac
aaacttcctgattcaattattgcatgtattggcggtggatctaatgctattggtatattt
tcagattttattaatgataaagttaatttaatcggagtagaaccggctggttatgggata
cacacaggaaaacatggggcaccattaaaacatggtagaaccggtatttattttggtatg
aaatcacatttgatgcaaaataaacagggtcagattcaagaatcttggtcaatttcagca
ggattagattttccatctgttggtcctgaacatgcttggttgaatagtattaaccgtgcg
aaatatgtctctattactgatgaggaagcaataagtgcatttcaggttttatctcgaaaa
gaaggcattattcctgctttagaatcttctcatgcattagcatatgcattaaaattaatg
aaaaaagatcctacaatagaacaaattttaattgctaatctttctgtcgtggagataaag
atatttttacagtacatgatgttttaa

DBGET integrated database retrieval system